KEGG   Actinoplanes sp. N902-109: L083_7026Help
Entry
L083_7026         CDS       T02655                                 

Definition
nad-glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:actn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    L083_7026
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L083_7026
   00330 Arginine and proline metabolism
    L083_7026
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    L083_7026
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     L083_7026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7999814..8004805)
Genome map
AA seq 1663 aa AA seqDB search
MPETDEAASDASLEAADPLLDFGPGPGLALTGRLGTSDDELDEPLPNAERLVAQAVALAG
EDHTTATLVDRFWRFAPDEELVGYTPQEMFDAAREHRELATARLPGELKLAISAPCPDQP
HTVISIVTDDMPFLVDSVTALLTAHQLQVHLLVHPLIVVRREPLGALAQVEANVEPDDAI
EGDLVESWIRVEIDPVRTEEAREQLHNALRRVLTDVRDAVDDWPRMRQRALVIADELAAA
RGSDRKLPVPDKDVTDSIELLKWLAHDHFTFLGYREYQLGEGGDSDLLTAVTGTGLGILR
SDQSTPRKLSSMAPEAHQRALEKRLLIITKANSRATVHRSAYLDYIGVKVFNDRGEVCGE
RRFLGLFSSSAYRTSVRELPVVRRKVMEVLDRSGLSPRGHSGKDLLQILETYPRDELFQI
KTDDLYEAVVGVLRMAGRRQLRLFLRRDGYGRFISCLIYLPRDRFTTGNRQAMQEILLRE
LNGIGVDYTTRVTERMLARVHFIVRTDPSDPPGGIDPNTLAEMLADATRMWDDDFSLVLE
RKLGEEPAKELFQRYTAAFPDSYKDGHTPYEAVQDIAKLELLEESGQLEMHLYRKRRLNR
EGCAEPDDTDVRFKVFRYGEPMMLSAVLPVLHSLGVRVVDERPYEVRRQDGTVYLYDFGL
LPPESHPELAEVRPQVENAFAAAWQNEAEVDGFNELVLRAGLTWRQVVVLRAYAKYQRQT
GAVFSQRYVESTFIAYPEIARLLLRLFETRFSPRLQIGEQERARRADDLVEQIGTLLDGV
DSLDQDRILRSYLTLINATLRTSFFQRGGDARPKSYVAFKLDPTAIPDLPQPRPKFEIFV
YSPRFEGVHLRFGAVARGGLRWSDRREDFRTEVLGLVKAQMVKNAVIVPVGAKGGFVLKQ
KPGDRDEAVECYKLFISALLDVTDNILSGKIVPPGDVVRHDGDDPYLVVAADKGTATFSD
IANEISVRREFWMGDAFASGGSAGYDHKKMGITARGAWESVKKHFRDLGTDTQSQDFTVV
GVGDMSGDVFGNGMLLSEHIRLVAAFDHRHIFLDPEPDAATSYAERRRLFDLPRSSWADY
DTALISAGGGVYPRSAKSIPVSPQIRAALGLGDATAVSPAELMRAILAAPVDLLWNGGIG
TYVKAAGETHADVGDKANDAIRVNGRDVRAKVVGEGGNLGLTQRGRIEYARGGGPVDASG
NPAGGRVFTDFIDNSAGVDCSDHEVNIKILLGGAVTDGELSLPERDELLAAMTDEVAALV
LRDNYEQATALGNARQQAHSLLPVHRRMLVSLEQSGQLNRELEALPTDKELAARYEAGEG
LTPPEFAVLLAYVKISLERQVLADPIVDEEWTHDVLARYFPTPLRDRFAARMSGHRLRRE
IISTTLVNEVVNRGGTSFVFRAMEESGASAADVIRAYVVVREVYGLADLWRAAEQLDNKV
PTFAQTLVYLETRRLLDRAVRWLVSNRRSPLDVAGEIDRLRAGVAGLLSDLPTVVQGTER
RSLEAHVDMLVGNGVPEGLARGVARVVYGFGMLDILETAKSTGLPATEVADVYFVISERF
NIDVLLSHISRLPRGDRWQTLARMALRYDLYSALAGLTAEVLQSTSPGGTPEDRVSEWEQ
VNAASIARAGNAMGDVAETPVDLAALSVLLRQIRTLVKTSAAG
NT seq 4992 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaaccgatgaggcagccagcgatgcgagtcttgaggcggcggatccgctgctc
gacttcggtcccggccccggtctcgctctgacgggccggctcggcacgtccgacgacgag
ctggacgagccgctgcccaatgccgagcgtctcgtcgcgcaggcggttgcgctggccggt
gaggatcacaccaccgcgacgctggtcgatcggttctggcggttcgcccccgacgaggag
ctcgtcggctacaccccgcaggagatgttcgacgctgcccgcgagcaccgcgagctggcc
accgcccggctgcccggggagctcaagctcgccatcagcgcgccctgcccggatcagccg
cacacggtcatctcgatcgtcaccgacgacatgccgttcctggtcgactcggtcaccgcg
ctgctgaccgcccaccagttgcaggtgcacctgctggtgcacccgttgatcgtggtgcgc
cgcgagccgctgggggcgctcgcccaggtcgaggccaatgtcgagcccgacgacgcgatc
gagggcgacctggtcgagagctggatccgcgtcgagatcgacccggtgcgcaccgaggag
gcgcgcgagcagctgcacaacgcgctgcgccgggtgctgaccgacgtgcgcgacgcggtc
gacgactggccccggatgcggcagcgggccctggtgatcgccgacgagctggccgccgcc
cgtggttccgaccgcaagctgccggtgcccgacaaggacgtcaccgactccatcgagttg
ctcaagtggctcgcgcacgaccatttcaccttcctcggctaccgggaataccaactgggc
gagggcggcgacagtgacttgctcaccgcggtgaccggcaccgggctcggcatcctgcgc
agcgatcagagcacgccgcgcaagctgtcgtcgatggctcccgaggcccaccagcgcgcg
ctggagaagcggctgctgatcatcaccaaggccaactcccgcgccaccgtgcaccgctcg
gcctatctggactacatcggcgtcaaggtcttcaacgaccgcggtgaggtgtgcggcgag
cggcgcttcctgggcctgttctccagctccgcctatcgcaccagcgtgcgcgagctgccg
gtggtccggcgcaaggtgatggaggtgctcgaccggtccggcctctccccgcgcgggcac
tccggcaaggatctcctgcagatcctggagacctatccgcgggacgagctcttccagatc
aagaccgatgacctgtacgaggcagtggtcggcgtcctgcgcatggccggccgccggcag
ctgcggttgttcctgcgccgcgacggctacgggcggttcatctcctgcctgatctacctg
ccccgggaccgtttcaccaccggcaaccgccaggccatgcaggagatcctgctgcgcgag
ctgaacggcatcggggtcgactacacgacccgggtgaccgagcggatgctggcgcgggtg
cacttcatcgtgcgcaccgacccctcggacccgccgggtggcatcgaccccaacacgctg
gccgagatgctggccgacgcgacccggatgtgggacgacgacttctccctggtgctcgag
cgcaagctgggcgaggaaccggccaaggagctgttccagcggtacaccgcggctttcccg
gacagctacaaggacggccacacgccgtacgaagcggtccaggacatcgccaagctggag
ctgctggaggagtccggccagctggagatgcatctctaccgcaagcggcggctcaaccgg
gagggctgcgccgagcccgacgacaccgacgtacgtttcaaggtcttccggtacggcgag
ccgatgatgctctccgcggtgctcccggtgctgcactcgctcggcgtccgggtcgtggac
gaaagaccctacgaggtacgccgccaggacggcacggtctacctgtacgacttcggtctg
ctgccaccggagtcgcacccggagctcgccgaggtccgcccgcaggtggagaacgcgttc
gcggcggcctggcagaacgaggccgaggtcgacgggttcaacgagctggtgctgcgggcc
gggctcacctggcggcaggtggtcgtgctgcgggcgtatgcgaagtatcagcggcagacc
ggtgcggtgttctcgcagcgctatgtggagtcgacgttcatcgcctacccggagatcgcc
cggctgctgctgcggctgttcgagacgcggttctcgccgcggctgcagatcggcgagcag
gaacgcgcccgccgcgccgacgacctggtcgagcagatcggcaccctgctggacggcgtg
gacagcctcgaccaggaccgcatcctgcgctcctacctgacgctgatcaacgccaccctg
cgcacgagcttcttccagcgtggtggcgatgcgcggcccaagtcgtacgtggccttcaag
ctggacccgacggccatcccggacctgccgcagccgcgcccgaagttcgagatattcgtg
tattcgccgcggttcgagggcgtgcacctgcgcttcggtgccgtcgcccgcggtgggctg
cgctggtccgaccggcgtgaggacttccgcaccgaggtgctgggcctggtcaaggcgcag
atggtgaagaacgccgtgatcgtgccggtgggcgccaagggcggcttcgtgctcaagcag
aagccgggcgaccgggacgaggcggtcgagtgctacaagctgttcatcagcgcgctgctc
gacgtcaccgacaacattctcagcggcaagatcgtgccgcccggcgacgtggtgcggcac
gacggcgacgacccctacctcgtggtggccgccgacaagggcaccgcgacgttctccgac
atcgccaacgagatctcggtgcgccgtgagttctggatgggcgacgccttcgcctccggt
ggctcggccggctacgaccacaagaagatgggcatcaccgcccgcggcgcctgggaatcg
gtcaagaagcacttccgcgacctgggcaccgacacgcagagccaggacttcaccgtggtc
ggcgtcggtgacatgtccggtgacgtgttcggcaacggcatgctgctgtccgagcacatc
cggctggtggccgcgttcgaccaccggcacatcttcctcgaccccgaaccggatgcggcc
acgtcctacgccgagcgccgccgcctgttcgacctgccacgctcgtcgtgggccgactac
gacaccgcgctgatcagcgcgggtggcggggtgtatccgcgctcggccaagtccatcccg
gtcagcccgcagatccgggcggcgctcggcctgggcgacgccaccgcggtcagcccggcc
gagctgatgcgcgcgatcctcgccgcgccggtcgacctgctgtggaacggcggtatcggc
acctacgtcaaggcagccggcgagacccacgccgacgtcggcgacaaggccaacgacgcg
atccgggtcaacggccgggacgtgcgcgccaaggtggtcggcgagggcggcaacctcggg
ctcacccagcgcggccggatcgagtacgcccgcggcggcggcccggtcgacgcctcgggc
aacccggccgggggccgggtgttcaccgacttcatcgacaactcggccggggtggactgc
tccgaccacgaggtgaacatcaagatcctgctcggcggcgcggtcaccgacggggagctg
tccctgcccgaacgcgacgagctgctggcggcgatgaccgacgaggtcgcggcgctggtg
ctgcgggacaactacgagcaggccacggcgctcggcaatgcccgccagcaggcgcattcc
ctgctgcccgtgcaccgccgcatgctcgtctcgctcgaacagtccggccagctcaaccgc
gagctggaggccctgcccaccgacaaggagctggccgcccgctacgaggccggcgagggg
ctcaccccgccggagttcgcggtgctgctggcgtacgtgaagatctcgctcgaacgccag
gtgctcgccgacccgatcgtcgacgaggagtggacgcacgacgtcctcgcccgctacttc
ccgacgccgctgcgcgaccggttcgccgcccggatgtccgggcaccggctgcgccgcgag
atcatctcgaccaccctggtcaacgaggtggtcaaccgcggcggtacctccttcgtgttc
cgcgcgatggaggagagcggtgcttcggcggccgacgtgatccgggcgtacgtggtggtc
cgcgaggtctatgggctcgccgacctgtggcgtgcggccgagcagctcgacaacaaggtc
cccacgttcgcccagacgctggtgtacctggagacccgccggttgctcgaccgcgcggtg
cgctggctggtcagcaaccgccgctccccgctcgacgtggccggcgagatcgaccggctg
cgcgcgggcgtggccggcctgctctccgacctgcccaccgtcgttcagggcacggaacgc
cggtccctcgaggcccacgtcgacatgctcgtcggtaacggcgtccccgaaggcctggcc
cgcggtgtggcccgggtcgtctacggcttcggcatgctcgacatcctggagacggccaag
tccaccggcctgccggccaccgaggtcgccgacgtctacttcgtcatctccgaacgtttc
aacatcgacgtcctcctctcgcacatctcccgcctcccgcggggtgaccgctggcagacc
ctggcccgcatggcgctgcgctacgacctctattccgccctggcgggcctgacggcggag
gtcttgcagtcgacctcgccgggcggcacccccgaggaccgggtgtcggagtgggaacag
gtgaacgccgcctccatcgcccgcgcgggcaacgccatgggcgacgtggcggaaaccccg
gtcgacctcgccgccctgtccgtcctgctccgccagatccgcaccttggtcaagacctcg
gcggctggctga

DBGET integrated database retrieval system