KEGG   Actinoplanes sp. N902-109: L083_7238Help
Entry
L083_7238         CDS       T02655                                 

Gene name
acbQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:actn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8224073..8225977
Genome map
AA seq 634 aa AA seqDB search
MATWYEDWHRERKDVSPDSVIGVLKLLGVDAGSPAAIKRELAAIRTAKEQKRLPGTVVVR
FGEAQPLAAPGVVTLEDGTERQVSEIPADLPLGWHTLRSADRQSTLVVVPAELPEPPESW
GWMLQLYSLHSAASWGMGDLGDLRTFVEHSQGAGLVLLNPLHAITPTLPVPSSPYSPSSR
RFANPLYLRVADTDAYRRADPPLREQVDALKPRPTADGLIDYSAVWQAKRAALELLWPLA
GEVDLDADPGLTDFATFCVLAERHGANWQEWPAELRRPDTPAVAEARRSDRVAFHVWLQQ
LLDQQLDAANQAARDQGMPVGIVHDLAVGIDPSGADGWLLQDVLAAGVHAGAPPDAFNQL
GQDWGLAAWRPDQLIETGYAAYRDMLRRIFRRAGGLRVDHVAGLWRLWWVPPGMGAAEGT
YVHYDPDAMLGILALEAHRAGAVVIGEDLGTVQPVVTETLERMNMLGSAVLWFTRDYEDD
PDEGYLPAARYPRNALASVSTHDLPTAAGFLVGEQVRVRAELGQLAGPVEDEQAYADKDR
AQLLTRLTEEGLITPDSTAEEIVTAMHAFLARTPSRLITASLYDVLGEVDQPNLPGTTDE
YPNWRMPLRESLEDIVADPRVTRVAAVLNARKPG
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacctggtacgaggactggcaccgcgagcgcaaggacgtgtcgccggactcggtg
atcggggtgctcaagctgctcggcgtggacgcgggcagcccggccgcgatcaagcgggag
ctggccgcgatccgcaccgccaaggagcagaaacgactgcccggtacggtcgtcgtccgg
ttcggtgaggcacagccgctggccgcccccggggtggtcacgctggaggacggcaccgag
cggcaggtgagcgagatccccgccgacctgccgctgggctggcacaccctgcgctccgcg
gaccggcagagcacgctggtcgtggtgccggccgagctgcccgaaccacccgagtcgtgg
ggctggatgctgcagctctactcgctgcactcggctgcgtcctggggcatgggcgacctc
ggcgacctgcgcacgtttgtcgagcacagccagggtgccgggctggtgctgctcaacccg
ttgcacgcgatcaccccgacgttgccggtgccgtcgtcgccgtactcgccgtccagccgc
cgcttcgccaacccgttgtacctgcgggttgccgacaccgatgcgtaccgccgggccgat
ccgccgttgcgggagcaggtggatgcgctcaagccgcggcccaccgcggacgggctcatc
gactacagcgcggtgtggcaggccaagcgggcggcgctggagctgctgtggccgctggcc
ggggaggtcgacctggacgccgatccgggcctgaccgacttcgcgaccttctgtgtgctc
gccgagcggcacggtgccaactggcaggagtggccggccgagctgcgccggccggacacc
cccgcggtggccgaggcgcgccgcagcgaccgcgtcgccttccacgtgtggctgcagcag
ttgctggaccagcagctcgacgcggccaaccaggccgcccgtgaccagggcatgccggtc
ggcatcgtgcacgacctggcggtgggcatcgaccccagcggagccgacgggtggctgctg
caggacgtcctcgccgccggggtgcacgcgggcgcaccgccggacgccttcaaccagctc
ggtcaggactgggggctcgctgcctggcggcccgaccagctcatcgagaccggctacgcg
gcctaccgcgacatgctgcgccgcatcttccggcgggcgggcggcctgcgggtcgaccac
gtcgccgggttgtggcggctgtggtgggtgccgccgggcatgggcgcggccgagggtacg
tacgtgcactacgacccggacgcgatgctcggcatcctggcgctcgaggcgcaccgcgcc
ggagccgtggtcatcggcgaggacctgggcacggtgcagccggtggtgaccgagacgctg
gaacggatgaacatgctcggctcggccgtgctgtggttcacccgtgactacgaggacgac
ccggacgagggctacctgccggccgcccgctatccacgcaacgcgctggcctccgtctcc
acccacgacctgcccacggccgccggcttcctggtgggcgagcaggtccgggtccgcgcc
gagctcggtcagctggccgggccggtcgaggacgagcaggcgtacgccgacaaggaccgg
gcgcagctgctcacccggctcaccgaggagggcctgatcacgccggacagcacggctgag
gagatcgtgacggcgatgcacgccttcctggcccgcaccccgtcccggctgatcaccgcg
tcgctctacgacgtcctgggcgaggtcgaccagcccaacctgccgggcaccacggacgag
taccccaactggcggatgccgctgcgggagagcctggaagacatcgtggccgacccgcgg
gtgacccgggtcgcagcggtgctgaacgctcgtaagcctggctga

DBGET integrated database retrieval system