KEGG   Actinoplanes sp. N902-109: L083_8103Help
Entry
L083_8103         CDS       T02655                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
actn  Actinoplanes sp. N902-109
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:actn00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    L083_8103
Enzymes [BR:actn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     L083_8103
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     L083_8103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9107010..9107861
Genome map
AA seq 283 aa AA seqDB search
MPEVEALAAYLRERAVGHTVERFEVSSFSALKTYDPAPSAIAGLRITGAGRHGKFLDVGL
GDDFHLVVHLARAGWLHYRDSFKSPAPLKPGSGPIAVRVRLDDGSGFDLTEAGTQKSLAA
YLVRDPAEVPGVSRLGPDALAVSRDEFAERIQLRNGQIKGVLTDQEVLAGIGNAYSDEIL
HVAKMSPFAMTKKLTDEQITTLYAAVRQVETDAVTRSVGQKAAELKGEKRAGMRVHARTG
LPCPVCGDTVREVSFADKSLQYCATCQTGGKPLADRRLSKLIR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaggtcgaggcgctcgccgcgtacctgcgtgagcgtgcggtcggccacaccgtg
gagcgcttcgaggtgtcctcgttcagcgcgctcaagacgtacgacccggcgccgagcgcg
atcgcgggtctccgcatcaccggcgccggccggcacggcaagttcctcgacgtcgggctg
ggcgacgacttccacctcgtcgtgcacctcgcccgggccggctggctgcactaccgggat
tccttcaagtcaccggcgccgctcaagccgggcagcgggcccatcgccgtacgggtgcgc
ctggacgacgggtcgggcttcgacctgaccgaggccggcacgcagaagtcgctcgcggcc
tatctcgtgcgcgaccccgccgaggtgcccggggtgtcccggctcgggccggatgcgctg
gccgtgagccgcgacgagttcgcggaacgcatccaactgcgcaacggccagatcaagggc
gtgctcaccgatcaggaggtgctcgccggcatcggcaacgcctattccgacgagatcctg
cacgtggccaaaatgtccccgttcgcgatgaccaaaaaattgactgacgagcaaatcacc
actctgtacgcggccgtgcgccaggtcgagacggatgcggtgacccgctcggtcgggcag
aaggcagccgagctcaagggcgagaagcgcgctgggatgcgggttcacgcccgcaccggc
ctgccctgcccggtgtgcggcgacacggtgcgtgaggtctcgttcgcggacaagagcctg
cagtactgcgccacgtgtcagaccggtggcaaaccgttggccgatcgccggttgtccaag
ttgatccgttag

DBGET integrated database retrieval system