KEGG   Acidithiobacillus caldus: Atc_0036Help
Entry
Atc_0036          CDS       T01581                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
acu  Acidithiobacillus caldus
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Atc_0036
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Atc_0036
Enzymes [BR:acu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Atc_0036
Peptidases [BR:acu01002]
 Cysteine Peptidases
  Family C44
   Atc_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37369..39204
Genome map
AA seq 611 aa AA seqDB search
MCGIVGGVADGDVLPHILEGLRRLEYRGYDSAGVALVSAAGGIVRRRSVGRVAELSALIA
RDALEGSIGIGHTRWATHGGVVEHNAHPLLSGEDIAVVHNGIIENFAELRQELQAQGYVF
GSETDTEVIAHLIHRERSRRPDLLSACRAAMEQLRGAFAIAVLSRSDPDRLCVARMGCPL
LLGLAESGQYFASDVAALLPVTRRVVYLEDGDLAEVTRSGIRIEDARGQVVARQEHWSQL
SPAAIDLGPYRHFMQKEIHEQPRAIADTLEGALQGPFSLQDLWGQEARERLGHVERVLFL
ASGTSHYASLVGRQWVETIAGIPAHAELGHEYRYRDSIPNPNQLIVTLSQSGETLDTWEA
LRRAKDLGHEETLSICNVAESAIPRASALRFITRAGPEIGVASTKAFTTQLVALYLLALS
LAILRGRLDDASLAQHLEHLRELPGGVQQALNLEPQIQLWAQRFADKDHALFLGRGLHYP
IALEGALKLKEISYIHAEAYPAGELKHGPLALVDQHMPVVVIAPNDRLLEKLAANMQEVR
ARGGELYVFADLDSHFEAAAGIHVIRLPRYAGLLSPVLHAIPVQLLAYHAALVKGTDVDR
PRNLAKAVTVE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgtcggtggcgtagcggatggcgatgtgttgccccacattctcgaggga
ttgcgccgtctggaataccgcggctacgactctgcaggggttgcgctcgtctcagcggcg
ggcggtatcgtgcgtcggcgcagcgtcggtagagtcgccgagctcagcgccctcatcgcc
cgcgacgccctcgagggcagcataggtatcggccacacccgttgggcgacccacggcgga
gtcgtcgagcacaatgcccatccgctcctctcgggggaggatattgccgtcgtccacaat
ggcatcattgagaatttcgccgagttacgccaggaacttcaggcgcaaggttatgtcttc
ggctcggaaacggacaccgaggtcatcgcccatctgatccatcgcgagcgatcccgacgg
cccgatctgctgagcgcctgtcgggcggccatggagcaactgcgcggggcctttgcgatc
gctgtactgagtcgcagcgatcccgatcgtctttgcgtcgctcgtatgggctgcccactc
ctgctgggactggccgagagtggtcagtattttgcgtccgatgtcgctgcactcctgccg
gtgacccggagagtcgtgtatcttgaggacggtgatctggccgaagtcacgcgcagcggt
attcgtatcgaggatgcccgtggtcaggtggtcgcgcgccaggagcactggagccagctg
agccccgcggccatcgatcttggtccgtatcgtcacttcatgcagaaagagatccacgag
caacctcgggccatagccgacaccctcgagggcgccctgcagggtcccttctctttgcag
gatctctgggggcaggaggcacgtgaacgcctggggcacgtggagcgtgtactttttctg
gcctcgggtaccagccactacgcgagcctcgttgggcgtcagtgggtcgagaccatcgcc
ggcatacctgcccatgccgagctcgggcacgagtatcgctatcgcgactccattcccaac
ccgaaccagctcatcgtcaccttgtcgcagtccggcgagaccctcgatacctgggaagcg
ctgcgccgggccaaggatctcgggcacgaggagaccttgtccatctgcaatgtggcggaa
agtgccatcccgcgggcctcggccctacgcttcattacccgggctgggccggaaatcggg
gtcgcctccaccaaggcctttaccactcagctggtggccctctacctcctggcgttgtcc
ttggccattctgcgcggtcgcctggatgatgcgagccttgcgcagcacctggagcacctg
cgcgagttgccgggtggggtgcagcaggccctcaacctcgaaccgcagatccagttgtgg
gcgcagcgctttgccgacaaggatcacgcccttttcctggggcgcggcctgcattacccc
atagccctggaaggcgccctgaagctcaaggagatctcctacatccatgccgaagcctat
cctgccggtgagctgaaacacgggcccctggctttggtggatcagcacatgccggtggtg
gtcatcgcgcccaacgatcgccttctggagaagctggccgccaatatgcaggaggtgcgg
gcgcggggaggagagctctacgtcttcgccgatctcgacagccatttcgaggcggcggca
ggtatccacgtcattcgactgcctcgctatgctggactgttgtcgcccgttctgcacgcg
atcccggtacagttgctcgcctatcacgcggccttggtaaaaggtacggatgtcgatcgt
ccccgtaatcttgccaaagccgtgacggtggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system