KEGG   Acidithiobacillus caldus: Atc_0036Help
Entry
Atc_0036          CDS       T01581                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
acu  Acidithiobacillus caldus
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:acu00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:acu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37369..39204
Genome map
AA seq 611 aa AA seqDB search
MCGIVGGVADGDVLPHILEGLRRLEYRGYDSAGVALVSAAGGIVRRRSVGRVAELSALIA
RDALEGSIGIGHTRWATHGGVVEHNAHPLLSGEDIAVVHNGIIENFAELRQELQAQGYVF
GSETDTEVIAHLIHRERSRRPDLLSACRAAMEQLRGAFAIAVLSRSDPDRLCVARMGCPL
LLGLAESGQYFASDVAALLPVTRRVVYLEDGDLAEVTRSGIRIEDARGQVVARQEHWSQL
SPAAIDLGPYRHFMQKEIHEQPRAIADTLEGALQGPFSLQDLWGQEARERLGHVERVLFL
ASGTSHYASLVGRQWVETIAGIPAHAELGHEYRYRDSIPNPNQLIVTLSQSGETLDTWEA
LRRAKDLGHEETLSICNVAESAIPRASALRFITRAGPEIGVASTKAFTTQLVALYLLALS
LAILRGRLDDASLAQHLEHLRELPGGVQQALNLEPQIQLWAQRFADKDHALFLGRGLHYP
IALEGALKLKEISYIHAEAYPAGELKHGPLALVDQHMPVVVIAPNDRLLEKLAANMQEVR
ARGGELYVFADLDSHFEAAAGIHVIRLPRYAGLLSPVLHAIPVQLLAYHAALVKGTDVDR
PRNLAKAVTVE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgtcggtggcgtagcggatggcgatgtgttgccccacattctcgaggga
ttgcgccgtctggaataccgcggctacgactctgcaggggttgcgctcgtctcagcggcg
ggcggtatcgtgcgtcggcgcagcgtcggtagagtcgccgagctcagcgccctcatcgcc
cgcgacgccctcgagggcagcataggtatcggccacacccgttgggcgacccacggcgga
gtcgtcgagcacaatgcccatccgctcctctcgggggaggatattgccgtcgtccacaat
ggcatcattgagaatttcgccgagttacgccaggaacttcaggcgcaaggttatgtcttc
ggctcggaaacggacaccgaggtcatcgcccatctgatccatcgcgagcgatcccgacgg
cccgatctgctgagcgcctgtcgggcggccatggagcaactgcgcggggcctttgcgatc
gctgtactgagtcgcagcgatcccgatcgtctttgcgtcgctcgtatgggctgcccactc
ctgctgggactggccgagagtggtcagtattttgcgtccgatgtcgctgcactcctgccg
gtgacccggagagtcgtgtatcttgaggacggtgatctggccgaagtcacgcgcagcggt
attcgtatcgaggatgcccgtggtcaggtggtcgcgcgccaggagcactggagccagctg
agccccgcggccatcgatcttggtccgtatcgtcacttcatgcagaaagagatccacgag
caacctcgggccatagccgacaccctcgagggcgccctgcagggtcccttctctttgcag
gatctctgggggcaggaggcacgtgaacgcctggggcacgtggagcgtgtactttttctg
gcctcgggtaccagccactacgcgagcctcgttgggcgtcagtgggtcgagaccatcgcc
ggcatacctgcccatgccgagctcgggcacgagtatcgctatcgcgactccattcccaac
ccgaaccagctcatcgtcaccttgtcgcagtccggcgagaccctcgatacctgggaagcg
ctgcgccgggccaaggatctcgggcacgaggagaccttgtccatctgcaatgtggcggaa
agtgccatcccgcgggcctcggccctacgcttcattacccgggctgggccggaaatcggg
gtcgcctccaccaaggcctttaccactcagctggtggccctctacctcctggcgttgtcc
ttggccattctgcgcggtcgcctggatgatgcgagccttgcgcagcacctggagcacctg
cgcgagttgccgggtggggtgcagcaggccctcaacctcgaaccgcagatccagttgtgg
gcgcagcgctttgccgacaaggatcacgcccttttcctggggcgcggcctgcattacccc
atagccctggaaggcgccctgaagctcaaggagatctcctacatccatgccgaagcctat
cctgccggtgagctgaaacacgggcccctggctttggtggatcagcacatgccggtggtg
gtcatcgcgcccaacgatcgccttctggagaagctggccgccaatatgcaggaggtgcgg
gcgcggggaggagagctctacgtcttcgccgatctcgacagccatttcgaggcggcggca
ggtatccacgtcattcgactgcctcgctatgctggactgttgtcgcccgttctgcacgcg
atcccggtacagttgctcgcctatcacgcggccttggtaaaaggtacggatgtcgatcgt
ccccgtaatcttgccaaagccgtgacggtggagtga

DBGET integrated database retrieval system