KEGG   Acidithiobacillus caldus: Atc_0082Help
Entry
Atc_0082          CDS       T01581                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
acu  Acidithiobacillus caldus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Atc_0082
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Atc_0082
Enzymes [BR:acu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Atc_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90778..91563
Genome map
AA seq 261 aa AA seqDB search
MDTLQEILQHKATEVAARRQRLGLAELQSAAALAAPPRDFVGALRQPQATGAAAVIAEIK
KASPSAGVIRENFNPVEIARDYAAHGAACLSVLTDERFFQGNDSYLTAARSAVNLPALRK
DFCIDPYQVWEARAIGADAILLIVAALGDDTLRELEALALDLGMAVLVEVHDAQELRRAL
ALRSPLLGINNRDLRSFTTSIQRSIDLLPAIPEDRLVISESGIRSPEDVATLRARGIHAF
LVGEALMREDAPGKALAQLFA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggataccctccaggaaattctccagcacaaggccacggaagtggcggcgcgacgtcag
cgtctgggccttgccgagctgcagtcggcggcggcccttgcggcaccgccgcgggatttc
gtcggcgccttgcgccagccccaggcgacgggggcggcggcggtcatcgccgagatcaag
aaagcttctccctcggccggggtcatccgtgaaaatttcaaccccgtggagatcgcccgc
gactacgctgctcacggtgccgcctgcctttcggtattgacggacgagcgtttttttcag
ggtaacgacagctacctcacggcggcgcgctcggcggtgaacctgccggccctgcgcaag
gatttctgcatcgatccctatcaggtctgggaggcgcgcgccatcggtgccgatgccatc
ctgctcatcgtcgcagccctcggcgacgataccctgcgtgagctggaggcccttgccctg
gatctgggcatggccgtcctggtggaagtgcacgacgcccaggaactgcggcgcgccctg
gctctgcgcagtcccctcttgggcatcaacaatcgcgacctgcgcagtttcaccacctcc
atccagcgcagcatcgacctgttgcccgccattcccgaggatcgcctggtgatcagcgaa
agtggcatccgcagcccggaggacgttgccaccctgcgcgctcgcggcatccacgcgttc
ctggtgggggaggcgctgatgcgcgaggacgctcccggaaaggccctggcgcaactgttt
gcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system