KEGG   Acidithiobacillus caldus SM-1: Atc_0082Help
Entry
Atc_0082          CDS       T01581                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acu01100  Metabolic pathways
acu01110  Biosynthesis of secondary metabolites
acu01130  Biosynthesis of antibiotics
acu01230  Biosynthesis of amino acids
Module
acu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Atc_0082
Enzymes [BR:acu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Atc_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C FMN_dh Phage_TAC_9
Motif
Other DBs
NCBI-ProteinID: AEK56733
UniProt: F9ZPC4
Position
90778..91563
Genome map
AA seq 261 aa AA seqDB search
MDTLQEILQHKATEVAARRQRLGLAELQSAAALAAPPRDFVGALRQPQATGAAAVIAEIK
KASPSAGVIRENFNPVEIARDYAAHGAACLSVLTDERFFQGNDSYLTAARSAVNLPALRK
DFCIDPYQVWEARAIGADAILLIVAALGDDTLRELEALALDLGMAVLVEVHDAQELRRAL
ALRSPLLGINNRDLRSFTTSIQRSIDLLPAIPEDRLVISESGIRSPEDVATLRARGIHAF
LVGEALMREDAPGKALAQLFA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggataccctccaggaaattctccagcacaaggccacggaagtggcggcgcgacgtcag
cgtctgggccttgccgagctgcagtcggcggcggcccttgcggcaccgccgcgggatttc
gtcggcgccttgcgccagccccaggcgacgggggcggcggcggtcatcgccgagatcaag
aaagcttctccctcggccggggtcatccgtgaaaatttcaaccccgtggagatcgcccgc
gactacgctgctcacggtgccgcctgcctttcggtattgacggacgagcgtttttttcag
ggtaacgacagctacctcacggcggcgcgctcggcggtgaacctgccggccctgcgcaag
gatttctgcatcgatccctatcaggtctgggaggcgcgcgccatcggtgccgatgccatc
ctgctcatcgtcgcagccctcggcgacgataccctgcgtgagctggaggcccttgccctg
gatctgggcatggccgtcctggtggaagtgcacgacgcccaggaactgcggcgcgccctg
gctctgcgcagtcccctcttgggcatcaacaatcgcgacctgcgcagtttcaccacctcc
atccagcgcagcatcgacctgttgcccgccattcccgaggatcgcctggtgatcagcgaa
agtggcatccgcagcccggaggacgttgccaccctgcgcgctcgcggcatccacgcgttc
ctggtgggggaggcgctgatgcgcgaggacgctcccggaaaggccctggcgcaactgttt
gcctaa

DBGET integrated database retrieval system