KEGG   Acidithiobacillus caldus: Atc_0242Help
Entry
Atc_0242          CDS       T01581                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
acu  Acidithiobacillus caldus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Atc_0242
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Atc_0242
Enzymes [BR:acu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Atc_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(252442..253428)
Genome map
AA seq 328 aa AA seqDB search
MVDLGGSELDAAERELLQDPAIGGVILFARNCLSALQVAELCREIRALRQPPLLIGIDQE
GGRVQRLREGVTRFPPQRALGRLAEAEGIESAIDLARDWGRLLAAELRDLGIDLDFTPCV
DIDWGVSEVIGDRALSDRPEWVAQLAGALWSGLQEQGLAGVAKHFPGHGAVTADSHTSLP
EDLRPWPLLQADLKPFRTLIAAGIPAIMPAHCLYPAVDPRNPAGFSRRWLQDILRGELGF
HGILVSDDLVMAGAAVVGGMAERVHAAQSAGAELLLVCNDRQAVEESLAVLHRGDLPAPR
LENLSARPATSPLSPAARDAIRTRLAKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggtggacctggggggcagcgagctggacgctgccgagcgcgagctcctgcaagatccg
gccatcggcggcgtcatccttttcgcccgtaactgtctgtcggccctgcaggtggcagag
ctttgtcgggagatacgggccttgcgccagccaccgttgctcatcggcatcgatcaggag
ggcgggcgggtgcagcgcctgcgcgagggcgttacccgctttccaccgcagcgcgctctg
ggacgtctggccgaggcggaagggatcgagagcgccatcgatcttgcccgcgactggggt
cgactgcttgccgctgagttgcgcgatctgggtatcgacctcgattttacgccctgtgtg
gatatcgactggggagtttccgaggtcattggcgatcgggccctgagcgaccggccggag
tgggtagcgcagttggcaggagcgctatggtctggcctgcaggaacagggccttgccggt
gtcgccaagcattttccgggacacggcgcagtgacggcggattcgcacaccagcctgccc
gaagacctccgtccctggccactgctgcaagcggatctgaagccttttcgtaccctcatc
gctgccggcatccccgccatcatgccggcgcactgcctctaccccgccgtcgaccccaga
aaccccgcaggcttctcgcgccgctggttgcaggacatcctccgtggggaattgggcttt
cacggaatcctcgtcagtgacgacctggtcatggccggggcggcggtggtggggggcatg
gccgagcgcgtgcacgcggcccagagcgcgggtgccgaactgctgctggtctgcaacgac
cggcaggcagtggaggaatccctggcggtcctgcatcgcggtgacctgcctgcgccgcga
ctggaaaacctttccgctcgcccggcgacatcaccgctcagccccgctgcgcgggatgcg
atccggacacgccttgccaagctctga

DBGET integrated database retrieval system