KEGG   Acidithiobacillus caldus: Atc_0255Help
Entry
Atc_0255          CDS       T01581                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acu  Acidithiobacillus caldus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Atc_0255
Enzymes [BR:acu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Atc_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(267939..269906)
Genome map
AA seq 655 aa AA seqDB search
MPHAPRDRSRILELLDDWHRAGWLGPLEPVLARWLAERDPDIAPELLFLAAITVHLEGLG
HTGLDVPAFFAQPLYYLDWPEQAGEALEEFLAQTGSGPETWQAALIRGGRMLAQHHDCSP
PISSQRGPETPLVWDGRRLYLRRHFRDEWEIARQLQSRASTTVAYFSEGSATLLTRLFGP
ASSSSAGDGQRLACALAAERGFTLITGGPGSGKTYTIARLLVLLMQAAPRRVALAAPTGK
AALRMDTALRQSVDDFVRRGDDDLADLLRQVPPAQTLHRLLGARPGTRRLRHDAHRPLNF
DLLVVDEASMIQHDLMAALLRATPARSQLILLGDPDQLASVEAGAVLAEICRGRAVYSPA
TAEDLKRRWGITLATDSLRDDASALEEAVVRLGSSYRFDGPIAKLATAIRSGDAERVIGL
LAASATVGDSALGWIDPRAGAGRANFLELAERAWRSTQTRLEPVPSGETEHAAWVRELLE
AADTFRILCALREGPWGVAGINARMTAQLRPPGYSGDWYPGRPVLVRRNDPIAGVYNGDL
GLVLPDTQGRLQVYFSRGPQLAPLRLHPRRLGDATSAYALTVHKAQGSEFQRVLLILPPE
DSPVLSRELLYTAVTRARREFIAVTPLETLGRILGRHGRRMSGLATRLFPEVSGH
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgccccacgccccccgcgatcgttcccgtatcctggagctattggacgactggcaccgt
gccggctggctcggccctctggagccagtcctggcccgctggctggccgagcgcgacccg
gacatcgcccccgaactcctcttcctcgccgccatcaccgtccacctcgaaggcctcggt
cacaccggtctggatgtgccggcttttttcgcccagcccctctactacctggactggcca
gaacaggccggtgaagccctggaggagttcctcgcacagacggggtctggaccagaaacc
tggcaggccgccctcatccgtggcggccgcatgctggcacagcaccacgactgctctccc
cccatttccagccagcgagggccggaaactcccctggtctgggatggacggcgtctgtac
ctgcgccggcattttcgcgatgaatgggagatcgcccgccagttgcaaagccgcgccagc
accaccgtcgcgtatttttccgagggctctgccaccctgctgacgcggctcttcggcccc
gccagcagctccagcgccggcgatgggcagcgcctcgcctgcgctctggccgccgagcgc
ggctttaccctcatcaccggtggacccggtagcggcaagacctacaccatcgcccgtctc
ctggtgctgctcatgcaagccgcgccgcggcgggttgcgctggccgctcccaccggcaag
gcggcgctgcgcatggacacagccctgcggcagagcgtcgacgattttgtccgacgcggc
gacgacgatcttgccgatctcttgcgtcaggttcccccggcccagaccctgcaccgcctc
ctgggggcccggcctggcacccggcgcctgcggcacgacgcccatcgtcccctgaatttc
gaccttctcgtggtggacgaggcttccatgatccagcacgacctgatggctgccctgctg
cgcgccacaccggcgcggtcccaactcatcctgctgggcgacccggatcagctggcctcg
gtggaggccggcgcggtgctggcggaaatctgccgtgggcgcgccgtttactcgccggcc
acggcagaggacctgaaaaggcgctggggcatcaccctggcgacggattccctccgcgac
gatgccagtgccctggaggaggcggtggtacggctgggcagcagctaccgcttcgacgga
cccatcgccaagctggccacggccatccgtagcggagacgccgagcgcgtgatcggcctc
ctcgcagccagcgccacggtgggggacagtgccctgggctggatcgatccccgcgcgggc
gctgggcgcgcaaacttcctggagctagccgagcgtgcctggcgctccacccaaacccgc
ctggagccggtccccagcggcgagacggaacacgctgcctgggtgcgcgaactgctagag
gctgccgacaccttccgcatcctgtgcgccctgcgcgaggggccctggggggttgccggc
atcaatgcccggatgacggcccagctgcgcccgccgggatattccggcgactggtatccc
gggcgtcccgtgctggtccggcgcaatgaccccatagccggtgtctacaacggtgacctt
ggcctcgtactcccggacacccagggacgattgcaggtctatttctcccgggggccacag
ctggcgccgctgcgcctgcacccccgtcgccttggcgacgccaccagcgcctatgccctc
accgtgcacaaggctcagggttccgagtttcagcgcgttcttctgatcctgcctcccgaa
gattcgccggtactcagccgcgagctactgtacaccgccgtcacgcgggcgcggcgcgaa
ttcatcgccgtcacccccctggaaacgctgggccggattctgggccggcatggacggcgc
atgagtggactggcgacgcgcctgttccccgaggtctctggccactga

DBGET integrated database retrieval system