KEGG   Acidithiobacillus caldus: Atc_0266Help
Entry
Atc_0266          CDS       T01581                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
acu  Acidithiobacillus caldus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:acu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:acu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(283685..284668)
Genome map
AA seq 327 aa AA seqDB search
MSTLHFGDGNLQYDGQGRLRHLLSIEGLRERDLLQILDTTESFLSIAQRTVKKTPTLRGR
TLVNLFFENSTRTRSTFELAAKRLSADVLNISASQSSTTKGESLLDTVDNLMAMQVDGFI
VRHPEAGAAHLLARHLGERALVVNAGDGQHAHPTQALLDVFTIRRLAGPVEQQVVCILGD
VLHSRVARALIHALSILGCPEIRVLGPRTLVPPEFASLGVQVHHDPRAALPGASIVYALR
LQRERMESHRLPSLDEFHRRFGLTPERLALAAPGALVLHPGPINRGVEIASTVVDGPQSV
VLAQVEHGLAVRMAVLSLLAGVPGHED
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccctgcattttggcgacggcaacctgcagtacgatggccagggacgcctgcgc
cacctgctcagtatcgagggcctgcgggagcgagacctcctgcagatcctcgataccacc
gagtctttcctgagcatcgcccaacggaccgtaaagaagacaccgacgctgcgcggtcgg
acgctggtgaatctgtttttcgagaacagcactcgtacccgcagcacctttgagctcgcc
gccaaacgcctatcggcggacgtgctcaacatcagcgcgagccaaagcagcaccaccaag
ggcgaaagcctgctcgacacggtggacaatctcatggccatgcaggtggacggttttatc
gtccgtcatccggaggcgggggccgcgcacctcctggcccggcacctgggggaacgggct
ctggtggtgaacgctggcgatggtcagcacgcccaccccacccaggcgctcctggacgtc
ttcaccatccgccgactggcgggacccgtggagcaacaggtggtctgtatcctgggtgat
gtgctgcactctcgggtcgcccgggccctgatccacgccctgtcgatcctgggctgcccc
gagatccgggtgctggggccgcgcaccctggtccctccggagtttgccagcctgggtgtc
caggtccaccacgacccgcgtgccgccctgcccggtgccagcatcgtctacgccctgcgg
ctgcagcgggagcgcatggaaagccaccgtctgcccagcctcgatgagtttcatcgccgc
tttggcctcaccccggagcgattggcgctggctgcacccggcgccctggtgctgcacccg
ggccccatcaaccggggtgtggaaatcgccagcaccgtcgtggatggaccgcagtccgtg
gtgctggcccaggtggagcatgggctggcggtgcgtatggccgttctcagtctgcttgcg
ggggtccctggccatgaagactga

DBGET integrated database retrieval system