KEGG   Acidithiobacillus caldus: Atc_0306Help
Entry
Atc_0306          CDS       T01581                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
acu  Acidithiobacillus caldus
Brite
Enzymes [BR:acu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Atc_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326240..326929
Genome map
AA seq 229 aa AA seqDB search
MLSHVSPEVGMISPRTRARMVARLQDEGIADERVLAAMAQLPRHLFVAEALSSRAYEPVS
LPIGFGQTISQPLVVARMLEVLLQEASPHRVLEIGTGSGYHCALLAMLGMEVFSIERIEA
LQRRAAATLARLSLEVHLRHGDGALGWPERAPFDAIVFTAAVPCALPPLFAQLRPGGVLL
MPVVENGRQRLRLRRWDGSRVEEQDLGPCHFVPLLAGTVSVSQEDTTWI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccatgtgagcccggaggtgggtatgatttccccgcgcacgcgggcacggatg
gtggcgcggctgcaagacgagggcatcgccgacgagcgtgtgctggccgccatggcgcag
ttgccgcgccacctcttcgtggcagaggccctgtcgagccgagcctacgagccggtctcc
ctgcccatcggcttcggtcagaccatctcccagcccctggtggtggcacggatgctggag
gtactgctgcaggaggcatccccccaccgggtcctggaaatcggtacgggctcgggttac
cactgcgcgctattggccatgctggggatggaggtgttcagtatcgagcgcatcgaagcc
ctgcaacggcgggcggcggccacccttgccagactctccctcgaggtgcatctgcgccac
ggggacggagccttgggctggccggaacgggcgcccttcgatgccatcgttttcacggca
gcggtgccctgcgccctgccgccgctctttgcccagctgcgtcccggcggtgtattgctg
atgcctgtggtggagaatggccggcagcggctgcgtctgcgccgctgggatgggtcgcgg
gtggaggagcaggatctcggtccctgtcacttcgtgcccttgttggcaggaacggtatcg
gtgtcgcaggaggatacgacgtggatctga

DBGET integrated database retrieval system