KEGG   Acidithiobacillus caldus: Atc_0355Help
Entry
Atc_0355          CDS       T01581                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
acu  Acidithiobacillus caldus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Atc_0355
  Amino acid metabolism
   00340 Histidine metabolism
    Atc_0355
Enzymes [BR:acu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Atc_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(373062..374357)
Genome map
AA seq 431 aa AA seqDB search
MKRLNSRDPHFTEALRQLHDWDANLDPLVENRVREILAAVRERGDAALLEYSARFDGLHL
ETAAELEIPRRDWEEALAALSAPEREALEEAAHRIRGYHERQKLESWQYREADGTLLGQR
VLPLARVGIYVPGGKAAYPSSVLMNALPARVAGVGEIHMTVPTPRGEVNPWVLAAAAVAG
VDRVFRLGGAQAVAALAYGTELVPAVDKIVGPGNTYVATAKRMVFGRVGIDMIAGPSEIL
VISDGSAPAEWLAWDLLSQAEHDELAQSIFIAWDAAHLEAVAAAVDHALSQLDRAPIARQ
SWQERGALILATDAADACRIADGIAPEHLELAVADPEALLDKIHNAGAIFLGIHSCEALG
DYVAGPNHVLPTGGSARFSSPLGVYDFVKRSSLIGASAAGAATLGALAERLARAEGLTAH
ARSAAARIPGH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctcaatagccgcgacccccactttaccgaagccctgcggcagctgcacgac
tgggacgccaatctggatccgctggtggagaatcgggtgcgggagatcctcgctgcggtg
cgggaacgcggcgatgcggcgctcctggaatactcggcgcgcttcgacggcctccacctc
gagaccgccgccgaactcgaaatcccgcgccgtgactgggaggaggcgctggccgccctg
agcgcgccggagcgtgaagccctggaggaagccgcccatcgtatccgtgggtatcatgag
cggcaaaaactggaatcctggcagtaccgagaagccgacggcacccttcttggccaacgc
gtcctgcccctggcccgggtcggcatctatgtgccgggaggaaaggccgcctaccccagt
tccgtgctcatgaacgccttgcccgcccgcgtcgccggcgtgggcgagatccacatgacc
gtgcccaccccgcgtggcgaggtgaatccttgggtgctggcggccgccgcggtggcgggg
gtggatcgcgtcttccgcctgggtggcgcccaggcggtggcggcgctggcctacggcacc
gaactcgtacccgccgtggacaagatcgtcgggcccggcaatacctacgtcgccacggcc
aagcgcatggtctttgggcgcgtgggcatcgacatgatcgccggccccagcgagatcctg
gtgatcagcgacggcagcgcgcccgccgagtggctggcttgggatctgctctcccaagcc
gagcatgacgaactagcccagagcatcttcatcgcctgggatgccgcccacctggaagcg
gtggctgcagccgtcgaccacgccctgagccaactggatcgcgctcccatcgcccggcag
agctggcaagaacgcggtgccttgatcctcgcgacggacgccgccgacgcctgccgtatc
gccgatggtatcgccccggagcacctggagctcgccgtggccgatcccgaggccctgctg
gacaagatccacaatgccggcgccatcttcctcggcatccacagttgcgaggccctgggc
gactacgtggccggtcccaaccacgttctgcccacgggcggtagcgcccgtttttcctcg
cccctgggcgtctacgacttcgtcaagcgtagcagcctcatcggtgccagcgccgccggt
gccgccaccctgggcgccctggcagagcgtctggcgcgggcggaggggctgaccgcccac
gctcgatccgccgccgcccgcatccccggccactga

DBGET integrated database retrieval system