KEGG   Acidithiobacillus caldus: Atc_0392Help
Entry
Atc_0392          CDS       T01581                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acu  Acidithiobacillus caldus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Atc_0392
   00052 Galactose metabolism
    Atc_0392
   00500 Starch and sucrose metabolism
    Atc_0392
   00520 Amino sugar and nucleotide sugar metabolism
    Atc_0392
Enzymes [BR:acu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Atc_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(402445..403341)
Genome map
AA seq 298 aa AA seqDB search
MELVRKAVFPVAGLGTRFLPATKASPKEMMPVVDKPLIQYAVEEAIAAGVDQLIFVTGRG
KRAIADHFDVSYELEMELEKKQKTALLDQVRAILPSHVSTIFLRQPYPLGLGHAVLMARP
VVGNEPFAVLLADDLMLATEPVLSQMVEQYRHYQAGILGVEEIPREHSSRYGVVDARPWD
DNIFQVSRIVEKPRPEDAPSNLGVVGRYILPARIFHFLEHLGSGAGGEIQLTDAIANLLG
ERQVLAYRFRGQRFDCGDKLGYLQATIAFAQLHPEVGPAFVRYLDGLCAARASEHKDA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgtgcgtaaagccgtattccccgtggcgggtctgggtacccgctttcttccc
gccaccaaggccagtcccaaggagatgatgccggtggtggacaagccgctcatccaatac
gccgtggaggaagccatcgccgccggcgtcgatcagctcatcttcgtcaccggtcgcggc
aaacgggccatcgccgaccacttcgacgtttcttacgaactggagatggagctggaaaag
aagcagaaaaccgcgctcctcgaccaggtgcgggccattctccccagccacgtcagcacc
attttcctgcgccagccctatcccttgggcctcggccacgccgtcctcatggcgcgtccg
gtggtgggtaacgagccctttgccgtacttttggcagacgatctgatgctggcaacggaa
cccgtacttagccagatggtcgagcagtatcggcactatcaggccggtattctgggcgtg
gaggaaatcccccgggagcacagttcgcgctacggcgtggtggatgccagaccctgggac
gacaacatcttccaggtcagtcgcatcgtcgaaaaaccccggccggaagacgcgccatcc
aatctcggcgtggtgggacgttacatcctgccggctcggatcttccactttctggagcat
cttggcagtggcgccggcggcgaaatccagctgacggacgccatcgccaaccttttgggt
gagcgccaggttctggcctaccgcttccgcggtcagcgcttcgactgtggcgacaagctc
ggctacctgcaggccaccattgcctttgcccagctgcatcccgaggttggtcccgccttc
gtgcgctacctcgacggactctgcgccgcccgtgccagcgagcacaaagatgcgtaa

DBGET integrated database retrieval system