KEGG   Acidithiobacillus caldus: Atc_0468Help
Entry
Atc_0468          CDS       T01581                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
acu  Acidithiobacillus caldus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:acu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Atc_0468
Enzymes [BR:acu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Atc_0468
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Atc_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480508..481320
Genome map
AA seq 270 aa AA seqDB search
MPELPEVEVTRLALAPHLEGQTLTGAVVRQKKLRQWVPPDLDSRLRGRVLNRLDRRGKYL
LADFVHGQLLLHLGMSGSLRLLPQDMAATVHDHVDILLGDGRCLRFRDPRRFGLILWNTE
GAAHPLLRDLGPEPLAENFSGQVLYRRSRGRQQAVKSFLMDSHTVVGVGNIYATESLFRA
GIDPRRAAGRISAARYDDLAMVIRTVLREAIAQGGTTLRDFFQPDGGNGYFRLSLQAYGR
EGEPCIRCGGTLRGQRLGGRATVFCPYCQH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgcctgaggtggaggtcacccgcctggccctcgcgccccacctggaggga
cagaccctgaccggcgcggtggtgcgccagaaaaagctgcgccagtgggtgcccccggat
ctcgatagccggttacggggacgcgtgctgaaccgcctggatcggcgcggcaagtatctg
ctggcggattttgtccacggccagctcctgctgcatctggggatgagcggtagtttgcgc
ctgctgcctcaggacatggcagcaacggtccacgatcacgtcgatatcctcctcggcgat
ggtcgctgtctgcgctttcgcgatccccggcgttttggcctgatcctgtggaataccgag
ggtgcagcccacccactgctgcgggacctggggccggagccgctggcggaaaatttttcc
ggccaagtgctgtatcggcgcagtcgcggccggcaacaggcggtcaagagcttcctcatg
gacagccacacggtggtgggcgtcggtaacatctacgctaccgaaagcctgttccgggcg
gggatcgacccgcgtcgagcagcaggccgcatctctgcggcacgctacgacgatctcgca
atggtcattcgcacggtgctgcgtgaggccatcgcccaaggcggtacgaccttgcgcgac
tttttccagcccgatggcggtaacggctattttcgactatctctacaggcctacggcaga
gagggggagccctgcatacgctgtggtgggactctgcgcggccagcgtctcggcggacgt
gccacggtcttttgtccgtactgtcaacattag

  All links  
No link information was found.   
DBGET integrated database retrieval system