KEGG   Acidithiobacillus caldus: Atc_0527Help
Entry
Atc_0527          CDS       T01581                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
acu  Acidithiobacillus caldus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Atc_0527
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atc_0527
   00052 Galactose metabolism
    Atc_0527
   00500 Starch and sucrose metabolism
    Atc_0527
   00520 Amino sugar and nucleotide sugar metabolism
    Atc_0527
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Atc_0527
   00524 Butirosin and neomycin biosynthesis
    Atc_0527
Enzymes [BR:acu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Atc_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543197..544144
Genome map
AA seq 315 aa AA seqDB search
MADNLCIGVDVGGTNLRFGVFRGAECLRCVRREVDLRQRCAAASDAEAAREIVLTALGEG
IHELLPDFPEVARVGLAFPGFVDHDGVLLKSPNIPQLENFALQRELGERLGLRVVAENDA
NAAAYGEFWEERQVHPELQDLLYVGLGTGVGGGWVHHCRPWRGAHGAAMEIGHLIVVPGG
RRCGCGNQGCLEQYASARGVQASYVEATGTAPEPAVIAQMARDGHAEARAAFALAGQCLG
QALAHVLKVADIGLLRVGGGLSAAWDCFAEDFLARLDQDLIPALRGSVEVKRGNNDDLAG
MRGAALLANDDPRRP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcggataatctgtgtatcggcgtcgacgttggcggcaccaacctgcgcttcggggtt
ttccgtggggcggagtgcctgcgttgtgtgcgacgcgaggtcgatctgcgccagcgctgc
gcggcggccagcgatgccgaggccgcccgggaaatcgtgctcacggcccttggcgagggc
attcacgagctcctgccggattttcccgaggtggcgcgggtggggctagcctttccgggc
ttcgtcgatcacgacggggtgctgctcaaatctccaaatattccccagttggagaatttt
gcgctgcaaagggaactgggggagcgtcttggtctgcgggtcgttgccgagaacgacgcc
aacgctgcggcctacggggagttctgggaagagcggcaggtgcatccggagttgcaggac
ctcctttacgtgggtttgggtacgggtgtgggaggcggctgggtgcatcactgtcggccc
tggcgcggtgcgcacggggcggccatggagattggtcacctcatcgtggtcccgggggga
cggcgctgcggttgcggtaatcagggttgcctcgagcaatacgcctcggcgcgcggcgtg
caggccagttacgtggaggccacgggcaccgcgccggaacccgccgtcatcgctcagatg
gcgcgtgacgggcatgccgaggcccgcgcggcctttgccttggctgggcagtgtctggga
caggccctggcccacgtcctcaaggtggccgatatcgggctgctgcgcgtgggtggcggg
ctcagtgcggcctgggactgttttgccgaggattttctggcccgtctcgatcaggacctg
atcccggccttgcgcgggtccgtcgaggtcaagcgcggcaataacgacgacctggcgggc
atgcgcggcgcggcactgctggccaacgacgacccccgccgcccctaa

DBGET integrated database retrieval system