KEGG   Acidithiobacillus caldus: Atc_0847Help
Entry
Atc_0847          CDS       T01581                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
acu  Acidithiobacillus caldus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Atc_0847
Enzymes [BR:acu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Atc_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847770..848915
Genome map
AA seq 381 aa AA seqDB search
MGATGSIGKSTLDVIGRHPEAFRVLALTGNHRVQEMLEIALRHSPEFVAMANPDAATALH
TALVAAGRDDIRVGSGTEALLEAVRWPGVSEVMAAIVGAAGLMPTLAAVRAGHRVYLANK
ECLVMAGSYFMEEVRRHDATLLPIDSEHNAVFQCFGDPKGVRRILLTASGGPFRTWPLER
LQDVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFSLPADQIDVLIHPQSIIH
SMVEYLDGSVLAQLGNPDMRTPIAHALAYPQRMHSGVSSLDLARGPALEFEEPDLARFPC
LGLAFAALRADGAAATVLNAANEVAVASFLDGRLPFSAIARLVEQTLTDYQPAQPTDLDA
VLDIDAEARRVAAAHLGLAAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgggggccacgggctccatcggcaaaagcaccctggacgtgatcggccggcacccggaa
gcgttccgggtcctcgccttgacgggtaaccatcgggtccaggaaatgctggagatagcc
ctgcggcactcgccggagttcgtggccatggccaacccggatgcggcgacggcgctgcac
acggccctggtggcagcgggtcgcgacgatatccgcgtgggcagtgggacggaggccttg
ctggaagcggtgcgatggccgggtgtgtctgaggtgatggcggccatcgttggcgctgcg
ggcctgatgccgaccctcgccgccgtgcgcgcagggcatcgcgtctatctggccaacaag
gagtgtctggtcatggccgggtcctacttcatggaggaggtgcgtcggcacgatgccacg
ctgctccccatcgatagcgaacacaatgccgtctttcaatgtttcggggacccgaaaggc
gtgcgccgcatcctgctgacggcatcgggggggcccttccggacttggcccctggaacgc
ctgcaggacgtcaccccggagcaggcctgtgcacaccccaactgggtgatgggacggaag
atctccgtggactcggcgaccatgatgaacaaaggcctggaggtcatcgaggcacactgg
ctgttctccctccccgcagaccagatcgatgtgctgatccacccgcagagcatcatccac
tccatggtcgaatacctggatgggtcggtgctggcgcagctcggcaatccggacatgcgc
acacccattgcccacgccctggcatacccgcagcgtatgcacagcggcgtatcctccctc
gacctggcgcgcggccctgccctggaattcgaggagccggaccttgcgcgctttccctgt
cttggtctggccttcgcggccctccgtgcggatggagcagcggctacggtgctcaatgcg
gccaatgaggtggcggtggcgtcttttctggacggtcgcttgcccttttccgccattgcc
cgtctcgtggagcagaccctcacggattaccagccggcgcagccaacggatctcgacgct
gtgctggacatcgatgccgaagcccgccgggtcgctgcggcgcaccttgggctggcagcc
gcctga

DBGET integrated database retrieval system