KEGG   Acidithiobacillus caldus SM-1: Atc_0847Help
Entry
Atc_0847          CDS       T01581                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00900  Terpenoid backbone biosynthesis
acu01100  Metabolic pathways
acu01110  Biosynthesis of secondary metabolites
acu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Atc_0847
Enzymes [BR:acu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Atc_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: AEK57496
UniProt: F9ZM14
Position
847770..848915
Genome map
AA seq 381 aa AA seqDB search
MGATGSIGKSTLDVIGRHPEAFRVLALTGNHRVQEMLEIALRHSPEFVAMANPDAATALH
TALVAAGRDDIRVGSGTEALLEAVRWPGVSEVMAAIVGAAGLMPTLAAVRAGHRVYLANK
ECLVMAGSYFMEEVRRHDATLLPIDSEHNAVFQCFGDPKGVRRILLTASGGPFRTWPLER
LQDVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFSLPADQIDVLIHPQSIIH
SMVEYLDGSVLAQLGNPDMRTPIAHALAYPQRMHSGVSSLDLARGPALEFEEPDLARFPC
LGLAFAALRADGAAATVLNAANEVAVASFLDGRLPFSAIARLVEQTLTDYQPAQPTDLDA
VLDIDAEARRVAAAHLGLAAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgggggccacgggctccatcggcaaaagcaccctggacgtgatcggccggcacccggaa
gcgttccgggtcctcgccttgacgggtaaccatcgggtccaggaaatgctggagatagcc
ctgcggcactcgccggagttcgtggccatggccaacccggatgcggcgacggcgctgcac
acggccctggtggcagcgggtcgcgacgatatccgcgtgggcagtgggacggaggccttg
ctggaagcggtgcgatggccgggtgtgtctgaggtgatggcggccatcgttggcgctgcg
ggcctgatgccgaccctcgccgccgtgcgcgcagggcatcgcgtctatctggccaacaag
gagtgtctggtcatggccgggtcctacttcatggaggaggtgcgtcggcacgatgccacg
ctgctccccatcgatagcgaacacaatgccgtctttcaatgtttcggggacccgaaaggc
gtgcgccgcatcctgctgacggcatcgggggggcccttccggacttggcccctggaacgc
ctgcaggacgtcaccccggagcaggcctgtgcacaccccaactgggtgatgggacggaag
atctccgtggactcggcgaccatgatgaacaaaggcctggaggtcatcgaggcacactgg
ctgttctccctccccgcagaccagatcgatgtgctgatccacccgcagagcatcatccac
tccatggtcgaatacctggatgggtcggtgctggcgcagctcggcaatccggacatgcgc
acacccattgcccacgccctggcatacccgcagcgtatgcacagcggcgtatcctccctc
gacctggcgcgcggccctgccctggaattcgaggagccggaccttgcgcgctttccctgt
cttggtctggccttcgcggccctccgtgcggatggagcagcggctacggtgctcaatgcg
gccaatgaggtggcggtggcgtcttttctggacggtcgcttgcccttttccgccattgcc
cgtctcgtggagcagaccctcacggattaccagccggcgcagccaacggatctcgacgct
gtgctggacatcgatgccgaagcccgccgggtcgctgcggcgcaccttgggctggcagcc
gcctga

DBGET integrated database retrieval system