KEGG   Acidithiobacillus caldus: Atc_0851Help
Entry
Atc_0851          CDS       T01581                                 

Definition
UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
Orthology
K02536  
UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
acu  Acidithiobacillus caldus
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Atc_0851
Enzymes [BR:acu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     Atc_0851
Lipopolysaccharide biosynthesis proteins [BR:acu01005]
 Lipid A
  Atc_0851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
853182..854264
Genome map
AA seq 360 aa AA seqDB search
MAGKAVSRSATTSASLAELAQVARAELRGDGHFQILGVAPLEAAGPHDLSFFQPPRSPQI
LAETRAGALILREQELSLYEGNALVSRNPYASFARVLQHLYPAPRPAPGVDEGAWIAVDA
HIHPAARIEAGVRVASGAVVEDGCWLETGVVVGAGVRLGAGCHLFPGVKVYAGVQIGPNC
SIHANAVIGADGFGFAPDGDAYLKIPHIGGVRIGRDVEIGANSCIDRGVMADTVIGDGVK
IDNLVQIGHNVRIGEHTVIAGQTGVSGSTTIGAHCRIGGQVGFAGHIRIADGCIIAGQSA
ITHDLRTPGVYSGVLPARPARRWRRLAARFDTLEEFVQRFKQWEKTAAARASAHREESDD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggaaaggccgtgagcaggtccgctaccacatcggcaagcctcgcggaattggcg
caggtcgccagggccgagttgcgcggtgacggccacttccagatactgggagtagcacct
ctggaagcggcgggaccccacgacctgagcttttttcaaccgccccgttcaccgcagatc
cttgccgagacccgcgccggtgccctcattctgcgggagcaggaactcagcctgtacgaa
ggcaacgcgctggtgagcagaaatccgtacgcaagcttcgcgcgtgtgctacagcatctc
tatccggcgcctcggccggcgccaggggtggacgagggggcctggattgccgtcgatgcc
cacatccaccccgctgcccgcatcgaggccggagtacgggtggcttcgggggcggtggtc
gaggatggctgttggctggagacgggtgtggtcgtcggtgctggtgtgcgccttggcgcg
ggctgtcacctctttcctggggtaaaggtctatgcgggcgtccaaattgggcccaactgc
agtatccacgccaatgccgtcattggcgccgatggtttcggctttgctccagacggggat
gcctacctcaagatcccgcacatcggcggagtgcgcatcggtcgcgatgtggagatcggc
gccaacagctgcatcgatcgcggggtgatggccgacaccgtcatcggcgatggcgtcaag
atcgataatctggtgcagattggtcataatgtccgcatcggcgagcataccgtcattgcc
ggccagaccggagtgtcgggcagtacgaccatcggggcacactgtcgcatcggcggccag
gtgggcttcgccggccacattcgcatcgccgatggctgcatcatcgcaggacagagcgcc
atcacccacgatctgcgtaccccgggggtgtactcgggagtgctgcccgcccgccctgcc
cgacgctggcggcgcctggcggcgcgcttcgacaccctggaggagtttgtgcagcgcttc
aagcaatgggaaaaaacggcagcggcccgtgcttctgctcaccgggaggagagtgacgac
tga

DBGET integrated database retrieval system