KEGG   Acidithiobacillus caldus: Atc_1056Help
Entry
Atc_1056          CDS       T01581                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
acu  Acidithiobacillus caldus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Atc_1056
Enzymes [BR:acu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Atc_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1053648..1055750)
Genome map
AA seq 700 aa AA seqDB search
MMATARSTPQGHAPGAPGLPPNWASARKTGVGTARNNHSRVWFTLADGIVTECYYPRVDT
PDLRDLQFLVLDPQGKVLEERRDLRTRLHWIEEGVPAYRIVSDDPEGRFSLIKEICTDPE
GDTLLIRLRFTQRSESNDPYRLFLLVAPQIGNHGMSNRASCEYAPDGRSWCAACREGIHI
AVTGSVPFQRMSAGYVGASDGWQDLHHHRDMRWTFAKAGPGHVALMAEMDIAEPEQTLVL
AFGTSQKDAREQGLRSLQRSFPEVLSEYCREWLAYQTGLHDLSHASHDGGRLYRRSAAIL
RCHFDKEEPGAGVASLSLPWGEQSDATSAQGGYHLVWPRDLYHLSMGLLAAGDRETPVQS
WHYLQRRQNADGSWSQNFWVDGTPYWQGLQLDEVAYPILLAWRLFQEGLIPDPSDTVHRA
ADFLVSQGPVTPQDRWEENRGYSPQTLAVVVTALRAASQLCDSKKGKAWGCNYHQVADSW
DQHIEEWTFTHCGQLLPGRPDHYERIAQIPVIDTGEHLPECRIFLPIRNLPAESMLSRSQ
CCVVDGGFLSLVRLGLRRPDDPHILKTLPVWDAVCRKETDCGPCWYRYNGDGYGEHEDGD
PFNGTGKGRLWPILTGERGHYAIAAGEDVSPYIRALECFANEGGCLPEQIWDQAAIPAKG
LYPGRGTGSATPLAWAHAEYIRLLRSRKDGAPFDRPTQLT
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaacagcacgctccacgccgcagggccacgccccaggggctccgggcctgccc
cccaactgggcctcagcgcgcaagactggggtggggaccgcgcgtaacaatcactcccgt
gtctggtttacgctggccgacgggatcgtgaccgaatgctactaccccagagtggacacg
cccgaccttcgggatctgcaattcctcgtgctcgaccctcagggcaaagtgttggaagaa
cgtcgggatctgcgcacgcgcctgcactggatcgaagaaggggtgccggcctaccgcatc
gtcagcgacgatccagaagggcgtttttctctgatcaaggagatctgtaccgacccggaa
ggcgacaccctcctcatccggctgcgttttacgcagcgtagtgagagcaacgacccatac
cgcctgtttctgctcgtggcaccccagattgggaaccacggcatgagcaaccgggcgagt
tgcgagtacgccccggatggtcgctcctggtgcgcggcatgccgagagggtatccatatc
gcagtaacgggaagtgtgcctttccaacggatgtcggctggctacgtcggcgcatccgac
ggctggcaggacctccatcaccatcgagatatgcgctggaccttcgcgaaggccggaccc
ggccatgtcgccctcatggctgagatggatattgcggaacccgagcagaccctcgttctc
gctttcgggacatcgcagaaggacgccagggagcaaggactgcgatcgcttcagcggagt
ttcccggaagttctgagtgaatactgtcgagaatggctggcatatcagactggtctccac
gacctgtcgcacgcgagccacgacggcgggcgcctataccgacggagcgcggcgattctc
cggtgccatttcgacaaggaggaacctggggctggggttgcctccctctctcttccttgg
ggtgaacaaagcgacgcgaccagcgcacaagggggttatcatctggtctggccgcgcgac
ctgtatcatctcagcatggggctgttggctgccggggatcgcgaaacgcccgtgcaatcc
tggcactacctgcagcgccggcaaaatgccgatggatcctggtcgcagaatttctgggtc
gatggaacgccttactggcagggattgcagttggatgaggtggcctatccgatcctgctc
gcctggcgtttattccaggaaggcctgattcccgatccgagcgataccgttcatcgagct
gcggattttctggtcagtcagggaccggtcacgccacaggatcgctgggaggagaatcgc
ggttacagtccgcaaaccctggccgtggtggtgacggccctacgtgccgcaagtcagctc
tgtgacagcaagaagggaaaagcctggggttgtaattaccatcaggtagcagattcctgg
gatcagcacatcgaggaatggacctttacccattgcggccaactgcttccaggccgtccg
gaccattatgagcgtatcgcacagatcccggtcatcgataccggagagcaccttcccgaa
tgccggatatttctcccaatccgtaatcttcccgccgagagtatgctcagtcggtcccag
tgctgtgtcgtcgatggcgggttcctgtccctcgttcgtctggggttgcgacgaccggat
gatccccacattctaaaaaccttgccggtatgggatgcggtttgccgaaaagaaacggat
tgtggtccctgctggtaccgctacaatggggacggctatggcgagcatgaggatggcgac
cctttcaacggcaccggcaaagggcgcctgtggcctattcttaccggtgagcgcgggcat
tacgccatcgccgcgggagaggacgtaagcccttacatccgcgctttggagtgttttgcc
aacgagggcggttgtctcccggagcagatatgggatcaggctgccatccccgcaaaaggt
ttatatcccgggcgcgggaccggttcggccacccccttggcgtgggctcatgccgagtat
atccggctgctgcgatcaaggaaggatggtgctccattcgataggccaacccaactgacc
taa

DBGET integrated database retrieval system