KEGG   Acidithiobacillus caldus: Atc_1121Help
Entry
Atc_1121          CDS       T01581                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acu  Acidithiobacillus caldus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:acu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1120679..1122862
Genome map
AA seq 727 aa AA seqDB search
MTKPRPPQTDAPDELLGGLIERVTFHNEGNGFCVLRVKARGHRELVTVVGHAAAVTAGEW
ITASGMWVTDRDHGQQFKAAFLKTSAPTSLEGIEKYLGSGMIRGIGPVYAKKLVRAFGDQ
VFTVIEEQPERLAEVEGIGPIRRERMVSAWADQKVIREIMLFLHAHGVGTARAVRIFKTY
GTDAVRILSENPYRLARDIQGIGFKTADAIAKKMGIEPQAPMRVRAGIAYALMEARDEGH
CGLPREALIPLAEKLLDVPTTAIESAIQEELLDGAIVADRVQDAECVFLASLYRNEQGIA
ELLHQLRTGPAPWADIAADTAIGWVQKRLGIALAQSQQSAIRMVLREKVALITGGPGVGK
TTLVNAILNILDAKRLRIALAAPTGRAAKRMSETTGKEAKTIHRLLEIDPQGGGFKRKED
YPLDIDLLVLDECSMIDVPLMHAILRALPRSAGLLMVGDPDQLPSVGPGQVLADLIAAKT
LPEVHLTEVFRQAAQSRIIQAAHRINAGHMPDLGKPEGQSDFYFIAVDDPAEAADKLVKL
VTTHIPRRFGLDPVQDIQVLCPMNRGALGARALNDALQAALNGESAPVVEKFGRRFAPGD
KVMQIQNDYEKEVFNGDLGTVHAVDMEEGTLTVDFEGRIVAYGFGELDLLQPAYAITVHK
SQGSEYPAVVIPMSTQHYPMLQRNLLYTAVTRGKALVVLLGQKKAVAMATRNGSRRRRWS
KLREWMR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagccgcgccctccgcagacggacgcccccgatgaattgctcggtggattgatc
gagcgggtcaccttccacaacgagggtaatggattctgcgtactgcgggtcaaagcccgc
ggccatcgggaattggtcacggtggtcggacatgccgctgcggtcaccgcaggggaatgg
atcaccgcctcggggatgtgggtcaccgatcgggaccatggccagcaattcaaagcagcc
tttctgaaaacctctgcgccgaccagcctggaggggatagagaagtacctgggctcgggc
atgatccgcggaattggcccagtctacgccaaaaagctcgtaagagcctttggcgaccag
gtcttcaccgttatcgaagagcagccggaacgtctggccgaggtagagggcatcggcccc
attcgccgggaacgcatggtcagcgcctgggcggaccaaaaagtcattcgtgagatcatg
ctcttcctgcatgcccacggggtgggtaccgctcgggcggtgcggatcttcaaaacctac
ggtaccgatgccgtgcggatcctgtccgaaaacccgtatcgactggcccgggatatccag
ggcatcggcttcaaaaccgccgatgccatcgccaagaaaatgggcatagaacctcaggcc
ccgatgcgggtccgggcggggattgcctatgccctgatggaggcgcgggatgagggccac
tgcggattaccccgggaagcactcattccacttgccgaaaagctattggacgtcccgacg
acggccatcgaaagcgccattcaggaagagttgctggatggggcaatcgtcgccgatcgg
gtgcaggacgcggaatgcgtttttctcgcttcgctgtaccggaacgagcaggggatagcc
gagctcctgcaccaactccgtaccggtccggccccctgggcagacatagccgcggatacg
gcgatcggctgggtgcaaaagcgtttgggcattgcgctcgcgcagagccagcaatcggcc
atccgcatggtactccgggaaaaggtggccctcattaccggtggcccgggggtaggaaag
accaccctcgtcaatgccatcctgaacatcctcgacgccaagcgtctgcgcattgctctg
gccgcaccgactgggcgcgcggccaagcgcatgagcgaaactaccggcaaagaagccaag
acgatccaccggctcctggagatcgatccccagggagggggattcaagcgtaaggaggac
tatcccctcgatatcgatctgctggtcctggacgaatgctccatgatcgacgtgccgctg
atgcacgccatcctcagggctctaccccgcagcgcggggctcttgatggtcggggacccc
gatcagctgccctcggtggggcccggtcaggtattggccgatctcattgcggccaaaacc
cttcccgaggtccatctgacggaagtctttcgccaggcggcacagagccggatcatccag
gcagcccatcggatcaacgcgggccacatgccggacttgggtaaaccggaggggcagagc
gatttctacttcatcgccgtggacgatccagccgaggccgccgataaacttgtcaagttg
gtcaccacccatatcccgcgccgcttcggcctggacccagtgcaggacatccaggtgcta
tgccccatgaatcgcggcgcgctcggggctcgtgccctaaacgatgcgctgcaagctgcc
ctcaacggcgaaagtgcgccggtcgtcgaaaagtttggccgtcgcttcgcgcctggggac
aaggtcatgcagattcagaacgactacgagaaggaggtattcaacggcgatcttggcacc
gtacacgccgtggatatggaggagggcaccctaaccgtggatttcgaggggcgaatcgtc
gcctatggattcggcgaattggacctgctccagccggcctatgcgatcaccgttcacaaa
agccagggttcggagtaccctgccgtggtgatccccatgagcacgcagcattaccccatg
ctgcagcgtaatctgctgtacacggcggtgacgcggggcaaggccctggtcgtgctcttg
gggcagaagaaagccgtggccatggccacccggaatggttccaggcgacggcggtggtca
aagttgcgggaatggatgcggtag

DBGET integrated database retrieval system