KEGG   Acidithiobacillus caldus SM-1: Atc_1121Help
Entry
Atc_1121          CDS       T01581                                 

Definition
(GenBank) Exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Atc_1121
Enzymes [BR:acu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Atc_1121
DNA repair and recombination proteins [BR:acu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Atc_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD HHH_2 AAA_29 T2SSE RsgA_GTPase AAA_16 NTPase_1 AAA PIF1 DUF2075 NACHT AAA_22 UvrD_C UvrD-helicase MMR_HSR1 ArgK cobW AAA_28 AAA_23 ABC_tran ABC_ATPase PhoH TsaE MobB AAA_18 DUF4314 RuvB_N DEAD AAA_3 TrwB_AAD_bind ATPase_2 ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: AEK57770
UniProt: F9ZLM0
Position
1120679..1122862
Genome map
AA seq 727 aa AA seqDB search
MTKPRPPQTDAPDELLGGLIERVTFHNEGNGFCVLRVKARGHRELVTVVGHAAAVTAGEW
ITASGMWVTDRDHGQQFKAAFLKTSAPTSLEGIEKYLGSGMIRGIGPVYAKKLVRAFGDQ
VFTVIEEQPERLAEVEGIGPIRRERMVSAWADQKVIREIMLFLHAHGVGTARAVRIFKTY
GTDAVRILSENPYRLARDIQGIGFKTADAIAKKMGIEPQAPMRVRAGIAYALMEARDEGH
CGLPREALIPLAEKLLDVPTTAIESAIQEELLDGAIVADRVQDAECVFLASLYRNEQGIA
ELLHQLRTGPAPWADIAADTAIGWVQKRLGIALAQSQQSAIRMVLREKVALITGGPGVGK
TTLVNAILNILDAKRLRIALAAPTGRAAKRMSETTGKEAKTIHRLLEIDPQGGGFKRKED
YPLDIDLLVLDECSMIDVPLMHAILRALPRSAGLLMVGDPDQLPSVGPGQVLADLIAAKT
LPEVHLTEVFRQAAQSRIIQAAHRINAGHMPDLGKPEGQSDFYFIAVDDPAEAADKLVKL
VTTHIPRRFGLDPVQDIQVLCPMNRGALGARALNDALQAALNGESAPVVEKFGRRFAPGD
KVMQIQNDYEKEVFNGDLGTVHAVDMEEGTLTVDFEGRIVAYGFGELDLLQPAYAITVHK
SQGSEYPAVVIPMSTQHYPMLQRNLLYTAVTRGKALVVLLGQKKAVAMATRNGSRRRRWS
KLREWMR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagccgcgccctccgcagacggacgcccccgatgaattgctcggtggattgatc
gagcgggtcaccttccacaacgagggtaatggattctgcgtactgcgggtcaaagcccgc
ggccatcgggaattggtcacggtggtcggacatgccgctgcggtcaccgcaggggaatgg
atcaccgcctcggggatgtgggtcaccgatcgggaccatggccagcaattcaaagcagcc
tttctgaaaacctctgcgccgaccagcctggaggggatagagaagtacctgggctcgggc
atgatccgcggaattggcccagtctacgccaaaaagctcgtaagagcctttggcgaccag
gtcttcaccgttatcgaagagcagccggaacgtctggccgaggtagagggcatcggcccc
attcgccgggaacgcatggtcagcgcctgggcggaccaaaaagtcattcgtgagatcatg
ctcttcctgcatgcccacggggtgggtaccgctcgggcggtgcggatcttcaaaacctac
ggtaccgatgccgtgcggatcctgtccgaaaacccgtatcgactggcccgggatatccag
ggcatcggcttcaaaaccgccgatgccatcgccaagaaaatgggcatagaacctcaggcc
ccgatgcgggtccgggcggggattgcctatgccctgatggaggcgcgggatgagggccac
tgcggattaccccgggaagcactcattccacttgccgaaaagctattggacgtcccgacg
acggccatcgaaagcgccattcaggaagagttgctggatggggcaatcgtcgccgatcgg
gtgcaggacgcggaatgcgtttttctcgcttcgctgtaccggaacgagcaggggatagcc
gagctcctgcaccaactccgtaccggtccggccccctgggcagacatagccgcggatacg
gcgatcggctgggtgcaaaagcgtttgggcattgcgctcgcgcagagccagcaatcggcc
atccgcatggtactccgggaaaaggtggccctcattaccggtggcccgggggtaggaaag
accaccctcgtcaatgccatcctgaacatcctcgacgccaagcgtctgcgcattgctctg
gccgcaccgactgggcgcgcggccaagcgcatgagcgaaactaccggcaaagaagccaag
acgatccaccggctcctggagatcgatccccagggagggggattcaagcgtaaggaggac
tatcccctcgatatcgatctgctggtcctggacgaatgctccatgatcgacgtgccgctg
atgcacgccatcctcagggctctaccccgcagcgcggggctcttgatggtcggggacccc
gatcagctgccctcggtggggcccggtcaggtattggccgatctcattgcggccaaaacc
cttcccgaggtccatctgacggaagtctttcgccaggcggcacagagccggatcatccag
gcagcccatcggatcaacgcgggccacatgccggacttgggtaaaccggaggggcagagc
gatttctacttcatcgccgtggacgatccagccgaggccgccgataaacttgtcaagttg
gtcaccacccatatcccgcgccgcttcggcctggacccagtgcaggacatccaggtgcta
tgccccatgaatcgcggcgcgctcggggctcgtgccctaaacgatgcgctgcaagctgcc
ctcaacggcgaaagtgcgccggtcgtcgaaaagtttggccgtcgcttcgcgcctggggac
aaggtcatgcagattcagaacgactacgagaaggaggtattcaacggcgatcttggcacc
gtacacgccgtggatatggaggagggcaccctaaccgtggatttcgaggggcgaatcgtc
gcctatggattcggcgaattggacctgctccagccggcctatgcgatcaccgttcacaaa
agccagggttcggagtaccctgccgtggtgatccccatgagcacgcagcattaccccatg
ctgcagcgtaatctgctgtacacggcggtgacgcggggcaaggccctggtcgtgctcttg
gggcagaagaaagccgtggccatggccacccggaatggttccaggcgacggcggtggtca
aagttgcgggaatggatgcggtag

DBGET integrated database retrieval system