KEGG   Acidithiobacillus caldus SM-1: Atc_1304Help
Entry
Atc_1304          CDS       T01581                                 

Definition
(RefSeq) Recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Atc_1304
DNA repair and recombination proteins [BR:acu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Atc_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1320986..1321585
Genome map
AA seq 199 aa AA seqDB search
MSESPSFTALTRLLRRLPGVGPRSSQRIAYDLLMRKRELMPALAMALQAAHEHIRSCSRC
NNLCEAELCAICSDTQRQRELLCVVESPVDLAAIEESGAYGGDYFVLMGHLSPLDGIGPE
DLHIDRFTARLAEPGLREVIFATNSTLEGEATAQFLAGYVPAGVRSSRIARGIPMGGELE
YVDRGTLGRALLGRRDLEE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaagccccagtttcaccgccttgaccaggctgctgcgccgtctaccgggggtc
ggcccgcgttcgtcgcaacgtatcgcctacgatctcctgatgcgcaagcgcgagctcatg
ccagccctggccatggcgctgcaggccgcgcacgagcatatccgttcttgcagccggtgc
aacaacctctgcgaggcggagctctgtgccatctgcagcgatacccagcgccaacgtgag
ctgctctgtgtggtggaatcgcccgtggacctggcggccatcgaggagtcgggcgcctat
gggggcgactatttcgtgctcatggggcatctctcgcccctggacgggatcgggccggaa
gacctgcacatcgaccgtttcacggcgcgtctcgccgagcccggcctgcgcgaggtcatt
tttgccaccaattcgaccctggagggagaagccactgcccagtttctggctggctatgtc
ccggcaggagtgcgcagcagtcgcatcgcccgcgggattcccatgggtggcgaactggaa
tacgtcgatcgcggtaccctggggcgggccctgctggggcgccgcgacctcgaagaataa

DBGET integrated database retrieval system