KEGG   Acidithiobacillus caldus: Atc_1514Help
Entry
Atc_1514          CDS       T01581                                 

Definition
inosine-5'-monophosphate dehydrogenase
Orthology
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
acu  Acidithiobacillus caldus
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Atc_1514
Enzymes [BR:acu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     Atc_1514
Exosome [BR:acu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Atc_1514
  Exosomal proteins of breast cancer cells
   Atc_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1553525..1554991
Genome map
AA seq 488 aa AA seqDB search
MQLIGEALTFDDVLLVPAHSAVLPREVAIGTRLSRHLSLNVPLVSAAMDTVTDAAMAICM
AQEGGIGIIHKNMTAEEQAAAVRRVKKFEAGVIKDPITTKADVSIREVLLLMAQHGISGV
PVVDGNRLEGIVTHRDLRFETRMEAPVRSVMTPRERLVTVPEGTSLEATKALLHQHRIEK
ILVVNDQFELRGLITVKDIRKATEHPLACRDSQGRLLVGAAVGVGAGTEERVRALVAAGV
DVLVVDTAHGHSQGVLDRVRWIKEQFPGVDVIGGNIATAEAALDLVAAGADGVKVGIGPG
SICTTRIVAGVGVPQITAISDVAKALADSDVPLIADGGVRFSGDFAKALAAGAHSVMVGG
LLAGTDEAPGEIELYQGRSFKAYRGMGSLGAMQQGSADRYFQENSANPEGPKLVPEGVEG
RVPYKGPAAGVIHQLLGGLRASMGYLGAADLQTLRQKARFIKITQAGVRESHVHDVHITK
EAPNYRVE
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgattggcgaagccttgacctttgacgatgtcctgttggtgccggcacattcc
gccgtcttgccgcgcgaggtggccatcggtacgcgcctcagtcggcaccttagcctcaat
gttccgctggtctctgcggccatggatacggtgaccgacgccgccatggctatctgcatg
gcgcaggagggcgggatcggcatcatccacaagaacatgaccgcagaagagcaggccgcc
gccgtgcgccgggtcaaaaaatttgaagccggggtcatcaaggaccccatcaccaccaag
gccgatgtcagcatccgcgaggtgctgctgctcatggcgcagcacggtatttccggggtg
ccggtggtggacggcaatcggctcgagggcatcgtcacgcaccgcgacctgcgctttgaa
acgcgcatggaggcgccggtacgcagcgtcatgacgccgcgcgaacgcctggtaacggtg
cccgaaggaaccagcctcgaggcgacgaaggcgctgttgcaccagcatcgcatcgaaaag
atcctcgtcgtcaacgaccaattcgaattacgcggcctcattaccgtcaaggatattcgc
aaggcgacggaacatcctctggcctgccgcgatagtcaagggcgcctgctggttggtgcc
gccgtcggcgtaggggcgggcaccgaggagcgcgtgcgggcgctggtggcggcgggtgtg
gatgtcctcgtcgtggacacggcccacggccacagccagggcgttctcgatcgggtgcgt
tggatcaaggaacaatttcccggggtggacgtcatcggcggcaatatcgccaccgccgag
gctgccctggatttggtcgcggcgggagccgatggggtcaaggtcggaatcggtccgggt
tccatctgcaccacgcgcatcgtcgctggtgtcggcgtacctcagatcacggccatcagc
gatgtcgccaaggccctggcggacagcgacgtgcccctcattgccgacggtggcgtgcgc
ttttccggtgacttcgccaaggccctggcggcgggcgcgcacagcgtcatggtgggcggc
ctgctggcgggcacggacgaggcccccggcgagatcgagctgtatcaagggcgctccttc
aaggcctatcgcggcatgggttcgctgggggccatgcagcagggctcggcggatcgctac
tttcaggaaaacagcgccaatcccgagggtccgaaacttgtccccgaaggtgtggagggc
agggtgccgtacaagggtccggcggcgggcgtcattcaccagctcctgggcggactgcgg
gccagtatgggatacctgggtgccgcggatctccagaccctgcggcagaaggcgcgcttc
atcaagatcacccaggcgggcgtgcgggaaagccacgtgcacgatgtccacatcaccaaa
gaagcacccaactaccgggtggagtga

DBGET integrated database retrieval system