KEGG   Acidithiobacillus caldus SM-1: Atc_1715Help
Entry
Atc_1715          CDS       T01581                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00330  Arginine and proline metabolism
acu00332  Carbapenem biosynthesis
acu01100  Metabolic pathways
acu01130  Biosynthesis of antibiotics
acu01230  Biosynthesis of amino acids
Module
acu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Atc_1715
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Atc_1715
Enzymes [BR:acu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Atc_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEK58363
UniProt: F9ZQE6
Position
complement(1764199..1765467)
Genome map
AA seq 422 aa AA seqDB search
MRQRQHEAVPTPRADVQAQAQRWVVKIGSSLLTNDGTGLDLAWIARWMEQIRHLHRAGKE
VVLVSSGAVSAGTALLGWSQRPGDLASRQAAASVGQSALIHHYEKILQQVARPEDPPLHC
GQVLLTHDELRNRKRYLNARNILRVLLDRNVLPVVNENDAISYRPIQLGDNDTLAAMVCN
LLDADLLVLLTDQDGLFSADPRRDPDACFLAEVTAGDPRLEAIAGGGGSGVGTGGMLAKV
KAAARAARSGTATVIAHGRHPDILPELVEGKAIGTFFRVRRPVLKARKRWLSDHLRVPGS
LILDDGAVRALREKGRSLLSVGVLRVEGEFHRGDLVACRAQDGREIARGLIDLDASVMRR
ILGHSRAELEQDPTIADSVVIHRDNLVLADPTGDWTPRQSSRQPPVSVPNPGQEPQEGGA
TE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagcgccagcacgaggcagtgccgacgccacgggcggacgtgcaggcccaggcc
cagcgctgggtggtcaagatcggcagcagtctgctgaccaacgatggcaccggtctggat
ctcgcctggattgcgcgctggatggagcagatccgccacctgcaccgcgcagggaaggag
gtggtgctagtgtcctccggcgcggtgagtgccgggacggccctgctggggtggagtcag
cgacccggcgatctcgcttcccggcaagcggcagccagcgttgggcaatccgctcttatc
caccactacgaaaagatcctgcagcaggtggctcgccctgaagatccgccgctgcactgc
ggtcaggtgctccttacccacgacgagctgcgcaaccgcaagcgctatctcaacgcccgc
aacattctcagggtgctcctggatcgtaacgtactgccggtggtcaacgagaacgacgcc
atttcctaccgacccatccaactgggcgacaacgataccctggcggccatggtctgcaat
cttctggatgccgaccttctggtgctgctgacggatcaggatggtctcttcagcgccgat
ccgcgcagagatcccgatgcgtgctttctggcagaggtgacggctggcgacccgcgcctc
gaggccatcgccggaggcggtggctcaggcgttggaacgggaggcatgctggccaaggta
aaagcggcagcccgcgcagcgcgatcgggtactgcgacggtgatcgcccacggtcgccac
cccgatatcctccccgaactggttgagggaaaagccatcggtaccttcttccgggtacgg
cgaccggtactgaaggcgcgtaaacgctggctctcggatcacctgcgcgtgcccggcagc
ctgattctggatgacggtgccgtgcgcgccctccgggagaaggggcgaagtctgctgagc
gtcggcgtgctgcgggtggagggggaatttcatcgcggcgatttggtcgcctgtcgtgcc
caggatggacgcgagatcgcccgcggtctcatcgatctggatgccagcgtcatgcgccgc
atcctgggtcatagccgcgcggaactggagcaggaccccaccatcgccgacagcgtcgtc
atccaccgcgacaacctcgttctggcggacccgacgggcgattggacgcccagacagagc
agccgccagccgccagtttccgttccgaacccgggacaggagcctcaggaagggggcgcg
acggagtag

DBGET integrated database retrieval system