KEGG   Acidithiobacillus caldus: Atc_1962Help
Entry
Atc_1962          CDS       T01581                                 

Definition
protoporphyrinogen IX oxidase, aerobic
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
acu  Acidithiobacillus caldus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:acu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2004418..2005782
Genome map
AA seq 454 aa AA seqDB search
MSSETVIVVGAGLTGLSATWYLHQRGIPALLLEAEAEVGGNLRSRSEDGFLRDLGPNSLM
IKGDLLPDLIRQLQLEDRVVEANPLARRRFVLNRRGHPVALGPDVLFSSSLLSLSARLRL
LSEPWRPRRPQSQNDESIADFVRRRLGPEALTWMVDPFVSGVFAGDPEKLSVTAALPRLA
AMEAESGSLLRAALRRRRAGKKEGSSRLVSFRGGLQELPRALAARLPPDRLALSRPLTHL
QRRGELWHLQTPAGDLECRRLVLALPAAESARLLRAEAPELAAELEAIVYPAVATVALGF
PREAVDHRLDGFGLLIPRRLGIETLGVLFSSTLFPERAPPGMVLLTAFLGGAQQDISGRS
PAELEAQALADLRPILGIRGDPAYHRCALWPRAIPQYALGHRQRVERIHELRRQLAGLEL
LGNWQGGVALGDCVVQADAFQRTFAQVDTATGPS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgaaacagtgatcgtcgtcggtgccggcctcaccggactgagcgccacctgg
tatctgcaccagcgcggcataccggctctgctgctggaggcagaagccgaggtgggcggc
aacctgcgcagccgctccgaagacggcttcctccgcgatctcggacccaactcactgatg
ataaaaggcgatctgctacccgacctgatccggcaactgcagctggaggaccgggtagtg
gaagccaacccgctggcacgccgccgtttcgtgctgaaccgccggggtcatcccgtggcg
ctggggccggacgtgctcttctcctcgtcgctgctgagcctgtcggcgcgcctgcgccta
ctgagcgagccttggcgcccgcgccgcccccagtcccagaacgatgagagcatagcggac
tttgtgcgtcggcgcttgggaccagaagccctcacctggatggtggatcctttcgtttcc
ggtgtctttgccggtgatccggaaaaactgtccgtaaccgccgctctgccccgccttgca
gccatggaagcggagtcgggctcgttgctgcgcgctgccctgcgcaggcggcgtgccggg
aagaaggagggcagcagtcgactggtctccttccgtggaggtctgcaggaattacctcgg
gcgctggccgcgcgtctgccaccagatcgcctggccttgtcccgaccccttacccacctg
cagcgccgcggggaactctggcacctgcagacgcccgcgggcgacctggaatgccggcgg
ctggtgctcgccctgcccgctgcggagagcgcccgtctgttgcgcgccgaagccccggag
cttgccgctgaactcgaggccatcgtctatccagcggtggccaccgttgccttgggcttc
ccccgggaagccgtggatcatcgcctggatggcttcggcttgctcattccccgccggctt
ggcatcgagaccctcggtgtgttgttctcttctaccctgttcccggagcgcgcaccgccg
ggcatggtcctgctcacggccttccttggtggtgcccagcaggacatatccgggcgcagt
cccgccgaactggaggcgcaggccctggcggatctgcgccccatcctcggcattcgcggt
gaccccgcctatcaccgctgtgccctgtggccgcgggccattccccagtatgccctcggc
catcggcagcgtgtggagcgcattcacgaattgcgccgccaactcgcggggctggaactg
ctggggaactggcaggggggtgtggcgttgggcgattgcgttgtccaggccgatgctttc
cagcgcacctttgcgcaagtcgacacggcaacgggcccaagctag

DBGET integrated database retrieval system