KEGG   Acidithiobacillus caldus SM-1: Atc_2171Help
Entry
Atc_2171          CDS       T01581                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00260  Glycine, serine and threonine metabolism
acu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
acu01100  Metabolic pathways
acu01110  Biosynthesis of secondary metabolites
acu01130  Biosynthesis of antibiotics
acu01230  Biosynthesis of amino acids
Module
acu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Atc_2171
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Atc_2171
Enzymes [BR:acu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Atc_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Dus PcrB ThiG Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: AEK58819
UniProt: F9ZS10
Position
complement(2221744..2222553)
Genome map
AA seq 269 aa AA seqDB search
MSRLTNCFSKLRGRTALIPFVTAGDPDPAATVPILHALVAAGADILELGVPFSDPMADGP
TIQRANERALSRGVHLRQVLAWVAEFREGNQHTPIVLMGYLNPIEAMGIEDFAREAAAVG
VDGTIIVDLTPEEGRRESAVLRSVGIDPIFLLAPTSGAERVAAVRELGSGFVYYVSLRGI
TGATQRDWHGVLERVQQLRAALSLPVAIGFGIRDAATARVLAQGGADAVVIGSALVERLA
DAADTAAQVAQAFLAPIAAALAEHARVSA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggctgacgaactgtttttccaagctgcgcgggcgcaccgcgctcatccccttt
gtcacggcgggcgatccggacccggcagccaccgtgcccatcctccacgctctggtggcc
gctggggccgatatcctcgagctcggcgtgcccttctcggaccccatggccgatggcccc
actattcagcgcgccaacgagcgggcgctgtcccgcggtgtccatctgcgccaggtcctg
gcctgggtcgcggaatttcgtgaggggaaccagcatacccccatcgtgctcatgggctat
ctcaaccccatcgaggccatggggatcgaggattttgcccgggaggcagccgcggtgggt
gtggatggtaccatcatcgtcgacctgacgcccgaagagggacggcgggagagcgccgtg
ctgcgctcggttggcatcgatcccatcttcctgctggcccccaccagcggtgccgaacgt
gtggcggcggtgcgcgagctcggcagtggtttcgtctattacgtctccctgcgcgggatc
accggggcaacgcagcgggattggcacggggtgctggagcgggtgcagcagttgcgcgct
gccctgagcctgcccgtagccatcggctttggtattcgcgatgctgccaccgccagggtg
ttggcccagggtggtgccgatgccgtggtgattggctcggctctcgtagagcggctcgcc
gatgcggcggacactgccgcgcaggtggcccaggcctttctggctcccatagcggcggcc
ttggcagagcacgcgcgggtgtcggcgtga

DBGET integrated database retrieval system