KEGG   Acidithiobacillus caldus: Atc_2431Help
Entry
Atc_2431          CDS       T01581                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
acu  Acidithiobacillus caldus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:acu00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2487124..2487672)
Genome map
AA seq 182 aa AA seqDB search
MKGMQWGSASTHTAAEDPVALLANLGVVWEALALPEHPEALALLARPTLDALEQEALLRA
LDPVFHPLQAERGYRERDLVVLYPEHPDLETLDRRFGGIHRHDDEEVRYIVDGEGVFGFV
LDDGRQLELTVEAGDYLHIPAGVEHWFRLNGLRRIKAVRYFSARGGWVPVYSDTPQQQFP
HA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatgcaatgggggagtgcctccacgcacacggctgcggaggacccggtagcc
ttgctggccaacctcggcgtggtctgggaggccttggccttgccggagcatcccgaagcc
ctggcacttctggcgcgtccgactctggacgcgctagagcaggaggccctgttgcgggcc
ctcgatccggtttttcatcctttgcaggcggagcgtggttatcgcgagcgggaccttgtg
gtcctctacccagaacacccggacctggagacgctggaccgacgttttggcggtatccat
cgccacgacgacgaagaggtccgctatatcgtcgatggcgagggtgtctttggctttgtg
ctggacgatggtcgtcagctggagctgacggtggaggccggcgactatctacatattccc
gcgggtgtggagcactggtttcggctgaatggactgcggcggatcaaggcggtgcgctac
ttcagtgcccgtggtggctgggtacccgtctacagcgacacaccgcagcagcagttcccc
cacgcatga

DBGET integrated database retrieval system