KEGG   Acidithiobacillus caldus SM-1: Atc_2535Help
Entry
Atc_2535          CDS       T01581                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00010  Glycolysis / Gluconeogenesis
acu00051  Fructose and mannose metabolism
acu00562  Inositol phosphate metabolism
acu00710  Carbon fixation in photosynthetic organisms
acu01100  Metabolic pathways
acu01110  Biosynthesis of secondary metabolites
acu01120  Microbial metabolism in diverse environments
acu01130  Biosynthesis of antibiotics
acu01200  Carbon metabolism
acu01230  Biosynthesis of amino acids
Module
acu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
acu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atc_2535
   00051 Fructose and mannose metabolism
    Atc_2535
   00562 Inositol phosphate metabolism
    Atc_2535
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Atc_2535
Enzymes [BR:acu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Atc_2535
Exosome [BR:acu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Atc_2535
  Exosomal proteins of bladder cancer cells
   Atc_2535
  Exosomal proteins of melanoma cells
   Atc_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEK59182
UniProt: F9ZSF7
Position
2593661..2594407
Genome map
AA seq 248 aa AA seqDB search
MHGLSADAQHLTQSILDAGLEPTVPEVVLFPPFTLLHTVSQVAKGTALRWGGQNLFWENQ
GAYTGEISGSMLRDMGCRYVLVGHSERRQLFGETDAVVLRKAQAALHTGLIPVICVGETG
DERQEGKTNAVLRRQIEALTPVLEHQGGGHQPHLVLAYEPVWAIGTGLTATPEQAEEAHA
FIRSLVAEHTPALAKKLLILYGGSVKANNAAALFAAEDIDGGLVGGASLQAGEFIQICRA
AHSVGRGV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcctcagtgccgatgcccagcatctgacccagtccatattggacgcgggtctc
gagcccaccgtgccggaggtcgtcctctttccccctttcacgctcctgcacaccgtaagc
caggtggccaagggtaccgccctgcgctggggaggacagaacctgttctgggaaaaccag
ggcgcctacaccggtgagatctccggttccatgctgcgcgacatgggctgccgctacgtc
ctcgtggggcactcggaacggcgccagctctttggcgaaacggatgccgtcgtcctgcgc
aaggcgcaggcagccctgcacaccggcctgataccggtcatctgtgtcggcgagaccgga
gacgaacgccaagagggaaagaccaatgccgtgttgcggcgtcagatcgaggccttgacg
ccggtgctggaacaccagggcgggggacatcaaccgcacctggtgctggcctacgaaccg
gtgtgggccatcggtaccggcctgaccgcaacgcccgagcaggccgaagaggcacacgct
ttcatccgctccctggtggcagaacacactccggcactggccaaaaagctgctcattctc
tacggcggcagcgtcaaggcgaacaacgccgcagcactcttcgccgccgaggatatcgac
ggtggtctcgtgggtggcgcctccctgcaggccggcgagttcatccagatctgtcgagcc
gcgcacagcgtcggtcgaggagtctaa

DBGET integrated database retrieval system