KEGG   Acidithiobacillus caldus: Atc_2535Help
Entry
Atc_2535          CDS       T01581                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acu  Acidithiobacillus caldus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Atc_2535
   01230 Biosynthesis of amino acids
    Atc_2535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atc_2535
   00051 Fructose and mannose metabolism
    Atc_2535
   00562 Inositol phosphate metabolism
    Atc_2535
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Atc_2535
Enzymes [BR:acu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Atc_2535
Exosome [BR:acu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Atc_2535
  Exosomal proteins of bladder cancer cells
   Atc_2535
  Exosomal proteins of melanoma cells
   Atc_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2593661..2594407
Genome map
AA seq 248 aa AA seqDB search
MHGLSADAQHLTQSILDAGLEPTVPEVVLFPPFTLLHTVSQVAKGTALRWGGQNLFWENQ
GAYTGEISGSMLRDMGCRYVLVGHSERRQLFGETDAVVLRKAQAALHTGLIPVICVGETG
DERQEGKTNAVLRRQIEALTPVLEHQGGGHQPHLVLAYEPVWAIGTGLTATPEQAEEAHA
FIRSLVAEHTPALAKKLLILYGGSVKANNAAALFAAEDIDGGLVGGASLQAGEFIQICRA
AHSVGRGV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcctcagtgccgatgcccagcatctgacccagtccatattggacgcgggtctc
gagcccaccgtgccggaggtcgtcctctttccccctttcacgctcctgcacaccgtaagc
caggtggccaagggtaccgccctgcgctggggaggacagaacctgttctgggaaaaccag
ggcgcctacaccggtgagatctccggttccatgctgcgcgacatgggctgccgctacgtc
ctcgtggggcactcggaacggcgccagctctttggcgaaacggatgccgtcgtcctgcgc
aaggcgcaggcagccctgcacaccggcctgataccggtcatctgtgtcggcgagaccgga
gacgaacgccaagagggaaagaccaatgccgtgttgcggcgtcagatcgaggccttgacg
ccggtgctggaacaccagggcgggggacatcaaccgcacctggtgctggcctacgaaccg
gtgtgggccatcggtaccggcctgaccgcaacgcccgagcaggccgaagaggcacacgct
ttcatccgctccctggtggcagaacacactccggcactggccaaaaagctgctcattctc
tacggcggcagcgtcaaggcgaacaacgccgcagcactcttcgccgccgaggatatcgac
ggtggtctcgtgggtggcgcctccctgcaggccggcgagttcatccagatctgtcgagcc
gcgcacagcgtcggtcgaggagtctaa

DBGET integrated database retrieval system