KEGG   Acidithiobacillus caldus: Atc_2808Help
Entry
Atc_2808          CDS       T01581                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acu  Acidithiobacillus caldus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Atc_2808
Enzymes [BR:acu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Atc_2808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2864948..2865736
Genome map
AA seq 262 aa AA seqDB search
MRELLRGKGIVVTRPKEQSGELIALLEAAGALPIPFPAIRIEAPENWQSLDAALTDLARF
QWAIFSSRNAVQFALSRLQALARQWPASTRIAAVGRETARALKDFGLGVDLVPERFSSEG
LLEHPALLEVRGERIALFAGDQGRELLERTLGERGALVEKVYCYRRSVPGANPTPLLHAW
ARGELQAVTVTSPEIFNNFYQMVGGLGQRWLKTTPIVAISPLTAEAITAKGLPAPWVAPE
ASNQGLLQALQDWAAHTEGSGK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagagagcttctgcgcggcaagggcatcgtcgtcacccgaccaaaggaacagtccggc
gaactcatcgccctgctggaagcggctggcgcacttcccatccccttcccggccatccgt
atcgaggcgccggagaactggcaatccctggatgccgccctgaccgatctggcgcgcttc
cagtgggcgatcttcagcagccgcaacgccgtccagtttgccttgagccgcctgcaggcg
ctggcgcggcagtggcccgcgtccacccgcatcgctgccgttggtcgggagaccgcgcgc
gccctgaaggatttcggcctcggcgtcgatctggtaccagaacgtttcagttccgagggg
ctgctggaacatcccgccctgctcgaggtgcggggggagcggatcgccctcttcgccggt
gatcaaggacgggagcttttggaacgtaccctgggtgagcgcggcgctctggtggaaaag
gtctactgttaccgacgcagtgtgcccggcgccaatcccacgccacttctgcacgcctgg
gctcggggtgaactgcaggccgtgacggtcacgagtccggagatcttcaacaacttctac
cagatggtcgggggtctcgggcagcgttggctcaagaccacgcccatcgtcgccatcagc
cccctgacggccgaagccattacggccaaggggctgcccgcgccctgggtggctccagag
gcgagtaaccagggtttactgcaggccctgcaggactgggccgcgcacacggagggttcg
ggaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system