KEGG   Acidithiobacillus caldus: Atc_2809Help
Entry
Atc_2809          CDS       T01581                                 

Definition
Porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
acu  Acidithiobacillus caldus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Atc_2809
Enzymes [BR:acu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Atc_2809
Exosome [BR:acu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Atc_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2865733..2866740
Genome map
AA seq 335 aa AA seqDB search
MTATLPIPPHFALRHQPRRLRRRAAMRAMLRETQLQASDFLLPIFLVEGTGVREEIASMP
GVFRHSIDSCLQLCGEAVARRIPGVLLFGVVAAQCKDASGSASWDSNGLVQRATRAIREH
YPDLLVIADACFCEYTDHGHCGVLAPDGDRDDPATLENLQRQALSYAEAGVDVIAPSGMV
DGMVLAIREALDAARYERVAVLSYAIKYASAFYGPFRDAADSAPSFGDRRAYQMDPANRR
EAFRELALDLEEGADMVMVKPAMPYLDILRDVRERCDFPVLAYQVSGEYSMLRAAAAAGA
LELQRSVLESLLAIKRAGADAIISYFAIEVADWLD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccactttacccattccaccccacttcgccctgcgccaccagccgcggcggctg
cgccgtcgcgcagccatgcgtgccatgctgcgcgagacccaattgcaggccagcgacttc
ctcttgccgatcttcttggtggagggtacgggtgttcgtgaggaaatagcctccatgccc
ggagttttccgccacagtatcgactcctgcctgcaactgtgcggcgaagcggttgcccga
cgaatccccggggttctgctctttggtgtcgtcgccgcgcagtgcaaggacgccagtgga
tctgcctcctgggacagcaatggtctggtgcaacgtgccactcgcgccatccgcgaacac
tacccggatctgctggtgattgccgacgcctgtttttgcgaatataccgaccatgggcac
tgcggggtactcgcccccgatggcgatcgcgacgatccagccaccctggagaatttgcag
agacaggccctgtcctatgccgaggccggcgtcgacgtcatcgccccctcgggcatggtg
gacggcatggtcctcgccattcgcgaggccctggatgcagcccgctacgagcgcgtcgcc
gtactctcctacgccataaagtacgccagcgccttttatggccccttccgcgacgcagcg
gacagcgccccaagcttcggcgaccgccgagcctaccagatggatcccgccaatcgccgg
gaggcctttcgggaactcgccctcgacctcgaggaaggtgcggacatggtcatggtcaag
cccgccatgccttacctcgacatactccgggacgtgcgcgagcgctgcgatttcccggtc
ctggcttatcaggtttccggcgagtacagcatgctgcgtgccgctgccgcggccggcgcc
ctcgaactccaacgcagcgtcctggagtccttgctggccatcaaacgtgccggcgccgat
gccatcatcagctactttgccatcgaggtcgcagactggctggactga

DBGET integrated database retrieval system