KEGG   Anabaena cylindrica: Anacy_0527Help
Entry
Anacy_0527        CDS       T02435                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
acy  Anabaena cylindrica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Anacy_0527
   00670 One carbon pool by folate
    Anacy_0527
Enzymes [BR:acy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Anacy_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645771..646271
Genome map
AA seq 166 aa AA seqDB search
MPLISLIAAISENRILADSTKEHIHVGIPWIIPTDERHFQEITWRHPVIMGRRTYSTFYQ
PLPNRTNIIVTRNLDYQAPGCVIFYSLLEAVEWAKMSETEEIFIAGGGDIYTEAIKFADK
LYLTIVEGNFEGDIYFPEFADFGKVTKEEHLQENGFKFKFVEMERV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaatcagcctcattgcagctatttctgagaatcggattttagctgattcaaca
aaggaacatattcatgtgggtattccttggattattcccacagatgaacgtcattttcaa
gaaattacctggcggcatcctgtgattatgggtcggagaacttattctactttttatcaa
ccgctgccaaatcgtacaaatataattgttaccagaaatcttgattatcaagctcccggt
tgtgttattttttattcacttttggaggcggttgaatgggctaaaatgagtgaaacggag
gagatatttattgctggtggtggagatatttatactgaggcgatcaaatttgcggataag
ctttatttgacaattgtggaaggtaattttgagggagatatatattttcctgagtttgca
gatttcggtaaagtaaccaaagaagaacatttgcaggaaaatggctttaagtttaagttt
gtggagatggaaagggtttag

DBGET integrated database retrieval system