KEGG   Anabaena cylindrica: Anacy_0645Help
Entry
Anacy_0645        CDS       T02435                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
acy  Anabaena cylindrica
Pathway
acy00900  Terpenoid backbone biosynthesis
acy01100  Metabolic pathways
acy01110  Biosynthesis of secondary metabolites
acy01130  Biosynthesis of antibiotics
Module
acy_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Anacy_0645
Enzymes [BR:acy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Anacy_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFZ56237
UniProt: K9ZCC5
Position
complement(783650..784603)
Genome map
AA seq 317 aa AA seqDB search
MHSYSLIAPAKINLYLEIIGNRPDGYHELAMILQSIDLADQIDVHAASTQTIRVYCDHPQ
VPIDQTNLAYRAAELMARKFPDAFSNFGGIDITIKKRIPVAAGLAGGSTNAAAVLVGIDL
LWNLGLTKSELEELGATLGSDVPFCISGGTVIATGRGEQLSPLPNLNHINIVLAKYRSLE
VSTPWAYQTYRQVFGSTYIKDTKDLVARANAVHSGEMVKAIVAKDAAEISQKLHNDLEKV
VLPAYPQVLQLRELFASQEGVLGTMMSGSGPSVFAIVESPAQAEVVKQQIRTAIPDEDLE
LFVTGTITTGIQIIRNS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcattcttatagcttaattgcacctgccaaaattaacttatatttggaaatcattggt
aatcgtcctgatggatatcatgagttagcaatgatactccaaagtattgaccttgcagac
caaattgatgtccatgctgccagcactcaaacaattcgcgtttactgcgatcacccacaa
gtacccatagatcaaaccaatctagcataccgggctgcggaactgatggccaggaaattt
cctgacgcttttagtaactttggcggtattgatattactatcaaaaaacggattcctgtc
gctgcgggtttagctggaggttcgacaaatgcagcagcagttttggtaggaatagattta
ctctggaacctgggactaactaaatcagaattagaagaattgggagctaccctgggttca
gatgtgccgttttgtatttctgggggaacagtaattgcaacaggtagaggtgagcaactt
tcccctttaccaaatttaaatcacataaatatagtattggcaaaatatcgcagtttagaa
gtttctactccttgggcatatcaaacctatcgacaagtatttggtagtacttatattaaa
gataccaaagatttagttgcccgtgccaatgcagtccattcgggagaaatggtgaaagcc
atcgtggctaaagatgcagcagaaatttctcaaaaactgcacaatgatttagaaaaagtc
gtattgccagcttatccccaagttctacaactgcgagaattatttgctagtcaagaagga
gttttaggaaccatgatgtctggttctggcccttctgtattcgcaattgtcgaatctcca
gcacaagcagaagtagtcaagcagcagatacgcacagcaatccctgacgaagatttagaa
ttgtttgtgactgggacaattacaactggaattcaaataattcgtaattcgtaa

DBGET integrated database retrieval system