KEGG   Anabaena cylindrica: Anacy_0645Help
Entry
Anacy_0645        CDS       T02435                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
acy  Anabaena cylindrica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:acy00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(783650..784603)
Genome map
AA seq 317 aa AA seqDB search
MHSYSLIAPAKINLYLEIIGNRPDGYHELAMILQSIDLADQIDVHAASTQTIRVYCDHPQ
VPIDQTNLAYRAAELMARKFPDAFSNFGGIDITIKKRIPVAAGLAGGSTNAAAVLVGIDL
LWNLGLTKSELEELGATLGSDVPFCISGGTVIATGRGEQLSPLPNLNHINIVLAKYRSLE
VSTPWAYQTYRQVFGSTYIKDTKDLVARANAVHSGEMVKAIVAKDAAEISQKLHNDLEKV
VLPAYPQVLQLRELFASQEGVLGTMMSGSGPSVFAIVESPAQAEVVKQQIRTAIPDEDLE
LFVTGTITTGIQIIRNS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcattcttatagcttaattgcacctgccaaaattaacttatatttggaaatcattggt
aatcgtcctgatggatatcatgagttagcaatgatactccaaagtattgaccttgcagac
caaattgatgtccatgctgccagcactcaaacaattcgcgtttactgcgatcacccacaa
gtacccatagatcaaaccaatctagcataccgggctgcggaactgatggccaggaaattt
cctgacgcttttagtaactttggcggtattgatattactatcaaaaaacggattcctgtc
gctgcgggtttagctggaggttcgacaaatgcagcagcagttttggtaggaatagattta
ctctggaacctgggactaactaaatcagaattagaagaattgggagctaccctgggttca
gatgtgccgttttgtatttctgggggaacagtaattgcaacaggtagaggtgagcaactt
tcccctttaccaaatttaaatcacataaatatagtattggcaaaatatcgcagtttagaa
gtttctactccttgggcatatcaaacctatcgacaagtatttggtagtacttatattaaa
gataccaaagatttagttgcccgtgccaatgcagtccattcgggagaaatggtgaaagcc
atcgtggctaaagatgcagcagaaatttctcaaaaactgcacaatgatttagaaaaagtc
gtattgccagcttatccccaagttctacaactgcgagaattatttgctagtcaagaagga
gttttaggaaccatgatgtctggttctggcccttctgtattcgcaattgtcgaatctcca
gcacaagcagaagtagtcaagcagcagatacgcacagcaatccctgacgaagatttagaa
ttgtttgtgactgggacaattacaactggaattcaaataattcgtaattcgtaa

DBGET integrated database retrieval system