KEGG   Anabaena cylindrica: Anacy_0939Help
Entry
Anacy_0939        CDS       T02435                                 

Definition
Glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
acy  Anabaena cylindrica
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Anacy_0939
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Anacy_0939
Enzymes [BR:acy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Anacy_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1111918..1114326
Genome map
AA seq 802 aa AA seqDB search
MTTPITLQIPSCTWNRPIGLGWDKPYTVRYPSNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHIFNTFPACQFSIFESTGISTKAYALSSQPPEDGTLQTWQWYPASSTTEET
GKYHALYPRSWFVYENVFQTDLTCEQFSPIWANNYQETSYPVAVFVWKAHNPTNAPITLS
IMLTWENMVGWFTNALKSPQVQIRDDGSPVYEYQPRLGASQGNYNQIVENTDHFSCFLGR
VASGEPVGEGDGSWSIATPKHPQVEIFYHTRWDSVGTGADIWQSFATDGSLANNQDATPA
DENTRLGAAIAIRFTLQPGETLEIPFTLAWDFPVTEFSAGINYYRRYTDFFGRNGENAGK
IATTGLLEYQNWRSHILTWQNPILDREDLPKWFKMALFNELYDLTSGGTLWSAASEIDPI
GQFAVLECLDYRWYESLDVRLYGSFALLMLFPELEKSVIRAFARAIPHSDDYLRVIGYYY
TIGADTTTAVRKVAGATPHDLGAPNEHVWEKTNYTCYQDCNLWKDLGSDFVLQVYRDFIF
TGGQDVEFLADCWDAIVQTLDYLKTFDLDGDGIPENSGAPDQTFDDWRLQGVSAYCGGLW
LAALESAIAICDILTNRRGAENAEKIRSQKSVYQSWLQQSLPIYQEKLWNGQYYRLDSES
GSNVVMADQLCGQFYARLLGLPDIVPNDNALSALQTVYDACFVKFCNGQFGAANGVRPDG
SPENPQATHPLEVWTGINFGLAAFLIQMGMKNEAMRLTQAVVQQIYDNGLQFRTPEAITS
AGTFRASTYLRAMAIWAIYLKS
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgacaacccccatcaccctgcaaataccatcctgtacttggaatcgtcctatcggttta
ggctgggacaaaccctataccgtccgttaccctagtaatattgatgatggcccttggcac
ggaatgccccttggtggttttggtgcaggttgtattggtcgttcctcacggggagatttt
aacttgtggcacattgacggtggtgaacatatattcaacaccttccccgcttgtcaattt
agtatatttgaatcaacgggtataagtactaaagcttacgctttatcaagccaacccccg
gaagatgggactttacaaacatggcaatggtatccagcatctagcactacagaggaaacc
gggaaatatcatgctttataccctcgtagttggtttgtttatgaaaatgtattccaaacg
gatctaacttgtgagcaattttcacctatttgggcaaataattatcaagaaactagttac
cctgtagcagtatttgtttggaaagcacacaaccctacaaatgcacctattactcttagc
attatgctgacttgggaaaatatggtgggttggtttactaatgctttgaaatcgccccaa
gtgcaaatacgggatgatggtagtccggtttatgagtatcagccacgtttaggtgcaagt
caaggtaattacaaccagatagtagaaaatacagatcacttcagttgttttttaggtcgg
gtagctagtggtgaacctgtaggagaaggtgatggtagctggtctattgcaacacccaaa
catccccaggtagaaatattttatcatacccgttgggattcagtggggacaggtgcggat
atatggcaaagctttgcaacagatggatctttggctaataatcaagatgcaactcccgca
gatgaaaatacgcgtttaggggcagcaattgctatccgttttactctccaaccaggagaa
actctggagattccctttactctggcttgggattttccagttacagaattttcggcagga
attaactattaccgcagatatacagacttttttggacgcaatggagagaatgcagggaaa
attgcgactactggattactagaatatcaaaattggcgatcgcacatcctaacttggcaa
aatcccattctcgaccgagaagatttgccaaaatggttcaaaatggcgttatttaacgaa
ctttacgacctcaccagcggcggaactctctggagtgcagcttcagaaatcgatcctatc
ggtcagtttgcagttttagaatgtttagattatcgctggtatgaaagtttagatgtcagg
ttgtatggttcttttgctttactgatgttattcccggaattggaaaaatcagtgattcgc
gcctttgcacgggcaatacctcacagtgatgactatctacgagtaattggctattactac
acaattggggcagacacgacaacagcagtccgcaaagtagccggtgcaactccacatgat
ttaggcgcacccaatgaacacgtttgggaaaaaaccaattacacctgctatcaagattgt
aatttgtggaaggatttgggtagcgattttgtcttgcaagtatatcgagattttattttt
acgggtgggcaggatgtggagtttttggcggattgttgggacgcaattgtgcaaactctc
gattacctgaaaacctttgatttagatggggatggtataccggaaaattcgggcgcacct
gaccaaacctttgatgattggcgcttgcaaggcgtgagtgcttattgtggtgggttgtgg
ttggcagctttggaaagtgcgatcgcaatttgtgatattttaacgaaccgcagaggcgct
gagaacgctgagaaaataagatcgcaaaaatcagtttatcaatcttggctacagcaatca
ctacctatctatcaggaaaagctttggaatgggcaatattaccgcttggatagtgaaagt
ggttctaatgtagtcatggcagatcagttgtgtgggcaattttacgccagactactgggt
ttacctgatattgtccccaatgataatgccctttcggctttgcaaacagtttatgatgct
tgttttgtaaagttttgtaatggtcaatttggtgctgctaacggcgttcgtcctgatggt
tcaccagaaaatccccaagctacccatccccttgaagtctggacaggtatcaatttcgga
ctagcagcttttctcatacagatgggcatgaaaaacgaagcaatgcgcttaacccaggct
gtagtacagcaaatttatgacaatggattgcagtttcgtaccccagaagcaattacatcg
gctggtacttttcgtgccagtacttatcttcgggcaatggctatttgggcaatttactta
aaatcttaa

DBGET integrated database retrieval system