KEGG   Anabaena cylindrica: Anacy_1108Help
Entry
Anacy_1108        CDS       T02435                                 

Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
acy  Anabaena cylindrica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anacy_1108
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anacy_1108
   00052 Galactose metabolism
    Anacy_1108
   00500 Starch and sucrose metabolism
    Anacy_1108
   00520 Amino sugar and nucleotide sugar metabolism
    Anacy_1108
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Anacy_1108
   00524 Butirosin and neomycin biosynthesis
    Anacy_1108
Enzymes [BR:acy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Anacy_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1309373..1310374)
Genome map
AA seq 333 aa AA seqDB search
MPYWENAMTLILALDFGGTKLAAATVKAGSREWLRHKNCLSPANADALSDVEIMRSLIDS
VLDRSKPDAIGVSFGGPVDAATGLVRLSHHVPGWENIPLKLLLEEEYHAPVSIDNDANVA
AIGEHRFGAGQGYDSLFYITISTGVGGGWILDGKPWRGALGMAGEIGHIVVDPAGPVCLC
GKRGCVERLASGPYMAQNARELLEKEAHHSPASTRGEILRDLVGNDLNLITGQVVSTAAA
QGDELAQAVLYKAAWALGVGIGNVANLMNPQRFVLGGGVTKAGDSFWATVRKVAQETALP
EVNFEVVRALLGDDAPLWGAVALGLDVKRLSIQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgccctattgggaaaatgccatgacgttaatattagctcttgattttggtggaactaaa
ctggcagcagcgacggtgaaagctggttctagagagtggttacgccataaaaattgcctc
tcacctgcaaatgcagatgccttgagtgatgtagaaattatgcgatcgctcattgactct
gtgctagatagaagtaaacctgatgctatcggtgtcagctttggtggcccagtagacgca
gccaccggactagtcaggctttctcatcatgtgcctggctgggaaaatattcctctcaaa
ctactgctagaagaagaatatcatgctcctgttagcatagataatgacgctaatgtggca
gctatcggcgaacatcgctttggcgctggacagggatacgatagcctgttttacatcact
atcagcaccggcgtaggtggaggttggatacttgacggtaagccgtggcggggtgcatta
ggtatggctggggaaattggtcatatagttgtagatcccgctgggccagtatgtttgtgc
ggaaaaaggggatgtgtcgaacgtttagcttctggcccctatatggcacaaaatgcacgg
gaacttttagagaaagaagctcatcattccccagctagtacaagaggagaaatactcagg
gatttagtaggtaatgacttaaacctgatcacaggacaagtagtcagtacagcagctgct
caaggggatgaattagcacaggcagttttatacaaagccgcttgggcgctaggtgtgggt
attggcaatgtcgccaacctgatgaatcctcaacgctttgttttaggtggtggtgtcact
aaagctggggatagtttttgggcaacagtacgcaaggtagcacaagaaacagcattacct
gaagttaattttgaagttgtgcgggcgttattaggtgatgatgcgccattatggggggct
gttgccttgggtttagatgtcaaaaggctctcgatacaatag

DBGET integrated database retrieval system