KEGG   Anabaena cylindrica: Anacy_1130Help
Entry
Anacy_1130        CDS       T02435                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
acy  Anabaena cylindrica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Anacy_1130
Enzymes [BR:acy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Anacy_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345062..1345976
Genome map
AA seq 304 aa AA seqDB search
MTIIVFGSINIDLVTTTPRLPIAGETLLGETFFKTPGGKGANQAVALAKLGIPTHMIGRI
GADSFGEELIENLQVSGVQTNNILITENVSSGVAIITVDHSGENHIVVIPGANAQVNQDD
IERLTHLLPEATAILLQLEIPIDVVVKAAKSARKANITVILDPAPAQSQLPDELYPLIDI
ITPNEIEASQLVGFPVNGEETAAKAATILLQRGVKCAVIKLGAKGVYCATTDQNFFIPAF
PVQAVDTVAAGDAFNAGLAAALFHKLPLREAVIWGAAAGALATTKLGAQSSLPDRMTLEK
FLLM
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgactattatcgtctttggcagcatcaatatagacttagtaacaacaaccccccgctta
ccaattgctggtgaaaccctactaggagaaaccttttttaaaacaccaggaggtaaaggt
gcaaatcaagccgtcgcattagcaaaattgggaattcctacccacatgataggacgtata
ggtgctgatagttttggtgaagaactcatcgaaaatttgcaagtctccggtgtccaaact
aataatattttaattactgaaaatgttagttctggggttgctatcatcactgtagatcat
agtggagaaaatcacatagttgtcattcccggtgcaaatgcacaagttaatcaagatgat
atagaaagattaactcatttattaccagaagcaacagccatacttttacaattagaaatt
ccgattgatgtcgttgttaaagctgccaaatctgcaaggaaagcaaatattaccgtaatt
cttgatcctgcaccagcacaatctcaattaccagatgaactttacccactcatagatatt
atcacacccaacgaaatagaagcgagtcaattagtaggttttcctgtcaatggagaagaa
acagcagcaaaagcagcaactattttattgcaacggggagtaaagtgtgcggtgataaag
ttgggtgcaaaaggtgtttattgtgccactactgatcaaaatttctttatcccagctttt
ccagttcaagcagttgatacagttgctgctggtgacgcttttaatgcaggtttagcagca
gcactttttcacaaactccctttacgcgaagcagtgatttggggtgcagcagcaggtgct
ttagcaacaacaaaattaggggcgcagagttctttacctgatagaatgactttagagaag
tttttactaatgtag

DBGET integrated database retrieval system