KEGG   Anabaena cylindrica: Anacy_1455Help
Entry
Anacy_1455        CDS       T02435                                 

Definition
Glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
acy  Anabaena cylindrica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anacy_1455
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anacy_1455
   00052 Galactose metabolism
    Anacy_1455
   00500 Starch and sucrose metabolism
    Anacy_1455
   00520 Amino sugar and nucleotide sugar metabolism
    Anacy_1455
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Anacy_1455
   00524 Butirosin and neomycin biosynthesis
    Anacy_1455
Enzymes [BR:acy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Anacy_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1706222..1707106
Genome map
AA seq 294 aa AA seqDB search
MGNQVIGIDLGGTAIKLGRFTEDGNCLQSLIVDTPQPATPEAVLSAIVDAISQIDPDNQT
IAIGVGTPGPADATGRIAKVAINLAGWHDVPLADWLEAKTGKPTILANDANCAGLGEAWL
GAGCNFPNLILLTLGTGVGGAIILDGKLFVGHQGAAAELGLITLNPDGPMCSSGNQGSLE
QHTAISAIRRRTGKEPAELGALAQAGDAQALNFWQEYGKDLGIGLTSLIYVLTPQAVIIG
GGVSASFEFFLPSMQAEIEKRVLPTSRLGLQILPAKLGNSAGMVGAAKLALTKI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatcaagtaattggtattgatttggggggaactgcaattaaactggggcgattt
acagaagatggtaattgtttacaatctttaattgtagatactccccaaccggcaacacca
gaagccgtattatctgcaatagtagatgccatatctcaaattgacccagataatcaaact
atagctataggtgtaggaactcctggccctgctgacgcaactggacgtattgctaaagtt
gctattaatttggcagggtggcatgatgtacctttagccgattggttagaagcaaaaact
ggaaaaccaactattttagctaatgatgctaactgtgcaggtttaggggaagcttggtta
ggtgcaggctgcaatttcccaaatttgattttactaactttagggactggagttggtggt
gcaattatccttgatggtaaattatttgttggtcatcaaggtgcagcagcagaattaggt
ttaatcaccttaaatcccgatggaccaatgtgtagtagtggtaatcaaggttctttggaa
cagcatactgcaatttctgctattcgtcgtcgcactggtaaagaaccagcagaattaggc
gcacttgcccaagctggagatgcccaagcattgaatttttggcaagaatatggtaaggat
ttaggaattggtttaacaagtttaatatatgttctcacaccacaagcagtaattattggt
ggtggtgtcagtgccagttttgaattttttttaccatcaatgcaagcagaaattgaaaag
cgtgttctgcctacttcacgtctaggtttacagattttaccagcaaaactgggtaactca
gcgggaatggtaggtgctgctaaattagcattgacgaagatctag

DBGET integrated database retrieval system