KEGG   Anabaena cylindrica: Anacy_1906Help
Entry
Anacy_1906        CDS       T02435                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
acy  Anabaena cylindrica
Pathway
acy00250  Alanine, aspartate and glutamate metabolism
acy01100  Metabolic pathways
acy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Anacy_1906
Enzymes [BR:acy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Anacy_1906
Peptidases [BR:acy01002]
 Cysteine Peptidases
  Family C44
   Anacy_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase QueC tRNA_Me_trans GATase_7 NAD_synthase ThiI GATase_6
Motif
Other DBs
NCBI-ProteinID: AFZ57394
UniProt: K9ZF71
Position
2174222..2175922
Genome map
AA seq 566 aa AA seqDB search
MFSYHFIGYWGYGQERLTQRRKGAKKEGEEGKFVWDVVYVGCESVASLLEDAIAGISAAG
VFDHLDVWVRLEEDRLILGREPFGKVSLFWTRQGGVIWFASQLQLLLEVIEKPEVSISGL
YGYGCFSYVPNPLTPVNEVFSVAAGTEVVWEDVGSPQFRNIYQWCESQEDIQDENTAVSQ
LQVLLKSSAEKQVADLPDEPVGVFLSGGLDSAVVAALLVQAGVKVRAYTLDFGKFGISEY
PYAEKVAEFLNIPLVKVEASPKNIKNALVPTIKALDLPFGDGVTVPLYLLNQVASQETQV
IFNGEGGDQLFAGWTNKPLIAAGIYQGEHPNKTEGFIQQYLRTFHRFWGYEGKVYQPDVY
AQIQGLDAQEWLLDALDSHFCPSLLHRLRRASLMLKGAQNIHPRATALGFAHGLGVRSLF
CDLILAEWTFQLSGELCLHGACEKYILKRAVENWLPPEIVWRQKRGMGVPLTSWCVNDFW
HDIGNWLNPGILKAENIFYPDIASQIVTGQLGGAIQGRRVGESLWLLVMWQLWRDHVFGE
KLGTKSWNHPFILPSWLWKNYKQFQI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgttttcctatcattttattgggtattggggttatgggcaagaaaggctcacgcaaagg
cgcaaaggcgcaaagaaagaaggtgaggagggaaagtttgtttgggatgttgtttatgtt
gggtgtgagtctgtagcttcgttattggaagatgctattgcgggtatttctgcggctggg
gtttttgatcatcttgatgtttgggtaaggttagaagaagataggttaattttgggtagg
gaaccttttggaaaggtttctttattttggactcggcaaggtggggtgatttggtttgct
tctcagttacaattacttttagaagttattgaaaaaccggaagttagtatttcgggttta
tatggttatggttgtttttcttatgttcctaatcctctgactcctgttaatgaggtgttt
tctgtagctgcgggtactgaggtagtttgggaagatgtgggttctcctcaatttcgcaat
atttatcaatggtgtgaatcacaggaggatattcaggatgaaaataccgcagtttctcaa
ttacaagttttattgaaaagttcggcagaaaagcaagttgctgatttaccagatgaacct
gtgggggtttttctttctgggggtttagattctgcggttgtcgcggctttgttggtacag
gctggggtgaaggttcgcgcttacactttagattttgggaagtttggtatttctgaatat
ccttatgcggaaaaagttgcagaatttctcaatattcctttagttaaggtagaggcaagt
cccaagaatattaaaaatgctcttgttcctactattaaagctttagatttaccttttggt
gatggggtgactgttcctttatatctcctcaatcaagttgctagtcaggaaactcaggta
atttttaatggtgagggtggtgatcaattatttgctggttggactaataagcctctgatt
gctgcgggtatttatcaaggggaacatcccaataaaacagaaggttttattcaacaatat
ctccgcacttttcaccgtttttgggggtatgaagggaaggtttatcagccagatgtatat
gcacagattcagggtttagatgctcaggaatggcttttggatgctctggatagtcatttt
tgcccttctttactgcatcgcctccgtcgtgccagtttgatgttaaaaggagcgcagaat
atccatcctcgtgcgactgcgttggggtttgctcatgggttgggagtgcgatcgctcttt
tgtgatttaattttagcagaatggacttttcagctatccggtgaactctgtttacacggt
gcttgtgaaaaatatatcctgaaacgtgcagtagaaaattggctaccaccggaaatcgtt
tggagacaaaagcggggtatgggtgttcccttaacttcctggtgtgtaaatgatttttgg
catgacatcggtaattggctaaatccaggtatactaaaggcagaaaatattttttaccct
gacattgcatcacaaattgttacaggacaattaggaggagcaattcaaggacgacgtgta
ggtgagagtctttggttactagtaatgtggcaactttggcgtgatcacgtttttggtgaa
aaattaggtacaaagtcttggaatcatccatttatcttacctagctggttatggaaaaat
tacaagcaattccaaatttag

DBGET integrated database retrieval system