KEGG   Anabaena cylindrica: Anacy_2253Help
Entry
Anacy_2253        CDS       T02435                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acy  Anabaena cylindrica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acy01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:acy00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:acy00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2534758..2535852)
Genome map
AA seq 364 aa AA seqDB search
MTLSLSVAKSHCQPWPGLIEAYREYLPVSESTPVVTLLEGNTPLIPVPAIAERIGKQVKV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMKPFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDRALEIVREMADSYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNITAYWMGFCQYHQDGKCDRLPKMMGFQAAGAAPLVN
GKPVANPETLATAIRIGNPASWDKAIAAQSASQGSFNAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSHAQFKQGIPADIKAVAEA
MGFE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcttgtctgttgctaaatctcattgccaaccttggcccggactgatagaa
gcctatcgtgaatatttgcctgtcagtgaaagcacgccagttgttactctattggaaggt
aacacacctttaatcccagtgccagcgatcgcagaacgcattggaaaacaggtcaaggta
tttgttaaatatgatggtcttaaccccaccggcagcttcaaagaccgggggatgacaatg
gcaatttctaaagccaaggaagcaggggctaaggcggtaatttgtgctagtacaggtaac
acctccgctgcggcggctgcttatgcccgacgtgggggaatgaaaccctttgtgttgatt
cctgatggttatgtggctttaggtaagttagcccaagccttactttatggcgcagaggta
ttagctattaaagggaattttgaccgagcgctagaaattgtccgggaaatggcagatagt
tatcccatcactttggtgaattctgtcaacccctaccgtttggaaggtcagaaaacagga
gcttttgaagttgtcgatgccttgggtaatgctcccgattggttatgtattccggtgggg
aatgcgggaaatatcacggcatattggatgggtttttgtcaatatcatcaagatgggaag
tgcgatcgcttaccgaaaatgatgggtttccaagctgctggtgctgcacctttggtaaat
ggtaaacctgtagcgaatcctgaaaccctagccacagcaattagaattggtaatcctgct
agttgggataaagcgatcgctgctcaatctgccagtcaaggtagcttcaacgccgtcaca
gatgaggaaatcctcgacgcttatcgacttttagcatcatctgaagggattttctgtgaa
cctgctagtgcggcttctgtcgccgggttgttaaaggtaaaagaccaagttcccacaggt
gcaacagtggtttgtgtcctcactggtaatggcttgaaagacccagatacagcaattaaa
cacagtcatgctcaatttaaacagggtattcccgcagacattaaagctgttgctgaggca
atgggatttgaataa

DBGET integrated database retrieval system