KEGG   Anabaena cylindrica: Anacy_2253Help
Entry
Anacy_2253        CDS       T02435                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acy  Anabaena cylindrica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Anacy_2253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Anacy_2253
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Anacy_2253
Enzymes [BR:acy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Anacy_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2534758..2535852)
Genome map
AA seq 364 aa AA seqDB search
MTLSLSVAKSHCQPWPGLIEAYREYLPVSESTPVVTLLEGNTPLIPVPAIAERIGKQVKV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMKPFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDRALEIVREMADSYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNITAYWMGFCQYHQDGKCDRLPKMMGFQAAGAAPLVN
GKPVANPETLATAIRIGNPASWDKAIAAQSASQGSFNAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSHAQFKQGIPADIKAVAEA
MGFE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcttgtctgttgctaaatctcattgccaaccttggcccggactgatagaa
gcctatcgtgaatatttgcctgtcagtgaaagcacgccagttgttactctattggaaggt
aacacacctttaatcccagtgccagcgatcgcagaacgcattggaaaacaggtcaaggta
tttgttaaatatgatggtcttaaccccaccggcagcttcaaagaccgggggatgacaatg
gcaatttctaaagccaaggaagcaggggctaaggcggtaatttgtgctagtacaggtaac
acctccgctgcggcggctgcttatgcccgacgtgggggaatgaaaccctttgtgttgatt
cctgatggttatgtggctttaggtaagttagcccaagccttactttatggcgcagaggta
ttagctattaaagggaattttgaccgagcgctagaaattgtccgggaaatggcagatagt
tatcccatcactttggtgaattctgtcaacccctaccgtttggaaggtcagaaaacagga
gcttttgaagttgtcgatgccttgggtaatgctcccgattggttatgtattccggtgggg
aatgcgggaaatatcacggcatattggatgggtttttgtcaatatcatcaagatgggaag
tgcgatcgcttaccgaaaatgatgggtttccaagctgctggtgctgcacctttggtaaat
ggtaaacctgtagcgaatcctgaaaccctagccacagcaattagaattggtaatcctgct
agttgggataaagcgatcgctgctcaatctgccagtcaaggtagcttcaacgccgtcaca
gatgaggaaatcctcgacgcttatcgacttttagcatcatctgaagggattttctgtgaa
cctgctagtgcggcttctgtcgccgggttgttaaaggtaaaagaccaagttcccacaggt
gcaacagtggtttgtgtcctcactggtaatggcttgaaagacccagatacagcaattaaa
cacagtcatgctcaatttaaacagggtattcccgcagacattaaagctgttgctgaggca
atgggatttgaataa

DBGET integrated database retrieval system