KEGG   Anabaena cylindrica: Anacy_2350Help
Entry
Anacy_2350        CDS       T02435                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
acy  Anabaena cylindrica
Pathway
acy00860  Porphyrin and chlorophyll metabolism
acy01100  Metabolic pathways
acy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Anacy_2350
Enzymes [BR:acy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Anacy_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA AAA_18 DUF815 ABC_tran AAA_28 tRNA_lig_kinase AAA_30 AAA_27 MMR_HSR1 AAA_7
Motif
Other DBs
NCBI-ProteinID: AFZ57806
UniProt: K9ZF38
Position
2652215..2653333
Genome map
AA seq 372 aa AA seqDB search
MTSTAQTKVSARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIPVVANDPFNSDPNDPDLMSDEVRQLLAEGGEIPIDHKKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEERGEFDQNP
AVYLEQHKTPQEALQQQIVNAQELLPKVNLDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALTSFEGRTEVTVDDIRRVITLCLRHRLRKDPLESIDTGYKVEKVFCRVFGVELPEDSA
QKNGTGMKTGVR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcaactgctcaaactaaagtaagtgcgcgtcgcgcggtctttccatttacagca
attgtcggccaggaagaaatgaaactggcattgttgttaaatgtgattgatcccaaaatt
ggtggtgtaatgattatgggcgatcgcggcaccggcaaatctacaaccatccgtgctttg
gcagacctgctgccagaaatccccgtagtcgctaacgaccccttcaatagtgaccccaat
gacccggatttgatgagtgatgaagtccgtcaattactagcagaagggggagaaattccc
atagatcataaaaaggtgcaaatggtagatttaccattaggcgcaactgaagaccgggtt
tgcggtactatcgacattgaaaaagctttatctgaaggtgtgaaagcttttgaaccaggg
ctactagccaaagctaacagagggattctttatgttgatgaagtcaacttattagatgac
cacttagtagatgtacttctcgattctgctgctagtggttggaacactgtggaacgggaa
ggtatttctatccgtcacccagcgcggtttgttctggttggttcgggaaatccagaagaa
ggggaattgcgtccccagttactcgaccgttttggaatgcacgcagaaattcacacggtg
aaagagccggctttgcgggtgcaaattgtggaagaacggggagaatttgaccaaaatcct
gccgtatatttagaacaacataaaactccccaggaagcattacaacagcaaattgtcaat
gctcaggaattattaccaaaagttaaccttgactatgacttgagggtaaaaatttcggaa
gtttgttcagaattagatgtagacggtttgcggggtgacattgttaccaaccgcgctgct
aaggctttaacctcatttgaaggacggacagaagttacagttgatgatattcgacgggta
attacattatgtctgcgtcaccgtttgcggaaagaccccttggaatccattgatactggc
tataaagttgaaaaagtgttttgtcgcgtttttggtgtggaattaccagaagactcagca
cagaaaaacggcacaggtatgaaaactggggttaggtaa

DBGET integrated database retrieval system