KEGG   Anabaena cylindrica: Anacy_2372Help
Entry
Anacy_2372        CDS       T02435                                 

Definition
Alkaline phosphatase D-related protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
acy  Anabaena cylindrica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:acy00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:acy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2679293..2680885
Genome map
AA seq 530 aa AA seqDB search
MNLNISQKLKRRQFLLQAAMTSSSIVATNLGSKSGLAQTPAFITLDKNRPSIPYGVASGD
INGNSAVIWSRCDCTARMIIEYAADENFRNSRRIWGQVAAANTDFTTRTYLGNLPPGQDI
FYRVTFQDLKDTNIYSAPVIGHLKTAPQGRGKDIFFAWSGDTAGQGWGINSEWGGMKIYE
SIRKLNPDFFIHSGDYIYADNPIKSEVSLDDGSIWKNITTEEKSKVAETLKEFRGNYIYN
LLDENVRRFNAQVSQLVQWDDHEVRNNWYPGQILDDGRYKVKDISLLASRAKQAFLEYTP
IRFNPQDPKRIYRSFNYGQSLDVFMLDKRSYRGKNSPNNQTVASTETAFLGSNQIRWLKN
QLKNSKATWKVIASDMPIGLIVRDGKTDFENAANGDGKALGRELELADLLSFIKNSNIQN
IIWLTADVHYAAAHYYDPNKAQFTDFKPFWEFVAGPLNAGNFGPAELDNTFGPEVKFQTA
SPDIKLNQAPSSGLQFFGAVKIDGKTEVLTVSLHNLEGQKIYSLDLPPEV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaatatttcgcaaaaactgaaacgtcggcaatttttattacaagctgcaatg
accagcagtagcattgtagcgacaaacctggggtcaaaatcaggtttagcacagacacct
gcattcatcacattagataaaaatcgcccgtctataccctatggtgttgctagtggggat
attaacggcaatagtgctgtcatttggagtcggtgcgattgcactgcacgaatgattata
gagtatgctgccgatgagaacttccgcaatagtcgtcggatatggggacaagtagctgcg
gctaatactgactttaccacccggacttatttggggaatctaccaccaggacaagatata
ttttaccgcgtcacttttcaagatttaaaagatactaacatttacagcgctccagtaatt
ggacatttgaaaactgctccccaaggaagaggaaaagatatattttttgcttggtctgga
gacaccgcaggtcaaggctggggaattaattccgagtggggtgggatgaaaatttacgaa
tctattcggaaactcaaccctgatttttttatccattcaggtgattatatttacgctgat
aatccgattaaatcggaagtaagcttagacgacggcagcatttggaaaaatatcactact
gaagaaaaatcaaaagttgccgaaaccttaaaggaatttcgcggcaactatatttataac
ttgttagatgaaaatgtgcgtcgttttaacgctcaagtttcgcaacttgtacaatgggac
gatcatgaagtgagaaataactggtatccagggcaaatattagatgatgggagatacaaa
gttaaggatatttctttattagcctcaagggcaaaacaagcatttttagaatatactcct
atccggtttaatcctcaagatccaaaacgcatttatcgctcttttaattatggacaatca
ctagatgtttttatgctagataaacgtagttatagaggtaaaaattctcctaataaccaa
acagtagcaagtacagaaacagcatttttgggtagtaatcaaatacgctggttaaagaat
cagttaaagaactcaaaagcaacttggaaagtaattgccagtgatatgcctattgggtta
atagttcgtgatggtaaaactgactttgaaaatgctgcaaatggagatggaaaagcatta
ggaagagagttagaattagctgatttattaagtttcataaaaaacagcaatatccaaaat
attatttggttaactgctgatgtacattatgccgcagcccactattatgatcctaataaa
gctcaatttaccgactttaaacctttttgggagtttgtcgctggacctctcaatgctgga
aattttggcccggctgaattagataatacatttggaccagaagtgaaatttcaaactgca
tctccagatattaagcttaatcaagcaccaagttcaggtttgcaattttttggagctgta
aaaattgatggcaaaactgaagttttaactgttagtttgcataatttggaaggtcaaaaa
atttatagtttagatttgcctccagaggtttag

DBGET integrated database retrieval system