KEGG   Anabaena cylindrica: Anacy_2372Help
Entry
Anacy_2372        CDS       T02435                                 

Definition
Alkaline phosphatase D-related protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
acy  Anabaena cylindrica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Anacy_2372
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Anacy_2372
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Anacy_2372
Enzymes [BR:acy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Anacy_2372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2679293..2680885
Genome map
AA seq 530 aa AA seqDB search
MNLNISQKLKRRQFLLQAAMTSSSIVATNLGSKSGLAQTPAFITLDKNRPSIPYGVASGD
INGNSAVIWSRCDCTARMIIEYAADENFRNSRRIWGQVAAANTDFTTRTYLGNLPPGQDI
FYRVTFQDLKDTNIYSAPVIGHLKTAPQGRGKDIFFAWSGDTAGQGWGINSEWGGMKIYE
SIRKLNPDFFIHSGDYIYADNPIKSEVSLDDGSIWKNITTEEKSKVAETLKEFRGNYIYN
LLDENVRRFNAQVSQLVQWDDHEVRNNWYPGQILDDGRYKVKDISLLASRAKQAFLEYTP
IRFNPQDPKRIYRSFNYGQSLDVFMLDKRSYRGKNSPNNQTVASTETAFLGSNQIRWLKN
QLKNSKATWKVIASDMPIGLIVRDGKTDFENAANGDGKALGRELELADLLSFIKNSNIQN
IIWLTADVHYAAAHYYDPNKAQFTDFKPFWEFVAGPLNAGNFGPAELDNTFGPEVKFQTA
SPDIKLNQAPSSGLQFFGAVKIDGKTEVLTVSLHNLEGQKIYSLDLPPEV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaatatttcgcaaaaactgaaacgtcggcaatttttattacaagctgcaatg
accagcagtagcattgtagcgacaaacctggggtcaaaatcaggtttagcacagacacct
gcattcatcacattagataaaaatcgcccgtctataccctatggtgttgctagtggggat
attaacggcaatagtgctgtcatttggagtcggtgcgattgcactgcacgaatgattata
gagtatgctgccgatgagaacttccgcaatagtcgtcggatatggggacaagtagctgcg
gctaatactgactttaccacccggacttatttggggaatctaccaccaggacaagatata
ttttaccgcgtcacttttcaagatttaaaagatactaacatttacagcgctccagtaatt
ggacatttgaaaactgctccccaaggaagaggaaaagatatattttttgcttggtctgga
gacaccgcaggtcaaggctggggaattaattccgagtggggtgggatgaaaatttacgaa
tctattcggaaactcaaccctgatttttttatccattcaggtgattatatttacgctgat
aatccgattaaatcggaagtaagcttagacgacggcagcatttggaaaaatatcactact
gaagaaaaatcaaaagttgccgaaaccttaaaggaatttcgcggcaactatatttataac
ttgttagatgaaaatgtgcgtcgttttaacgctcaagtttcgcaacttgtacaatgggac
gatcatgaagtgagaaataactggtatccagggcaaatattagatgatgggagatacaaa
gttaaggatatttctttattagcctcaagggcaaaacaagcatttttagaatatactcct
atccggtttaatcctcaagatccaaaacgcatttatcgctcttttaattatggacaatca
ctagatgtttttatgctagataaacgtagttatagaggtaaaaattctcctaataaccaa
acagtagcaagtacagaaacagcatttttgggtagtaatcaaatacgctggttaaagaat
cagttaaagaactcaaaagcaacttggaaagtaattgccagtgatatgcctattgggtta
atagttcgtgatggtaaaactgactttgaaaatgctgcaaatggagatggaaaagcatta
ggaagagagttagaattagctgatttattaagtttcataaaaaacagcaatatccaaaat
attatttggttaactgctgatgtacattatgccgcagcccactattatgatcctaataaa
gctcaatttaccgactttaaacctttttgggagtttgtcgctggacctctcaatgctgga
aattttggcccggctgaattagataatacatttggaccagaagtgaaatttcaaactgca
tctccagatattaagcttaatcaagcaccaagttcaggtttgcaattttttggagctgta
aaaattgatggcaaaactgaagttttaactgttagtttgcataatttggaaggtcaaaaa
atttatagtttagatttgcctccagaggtttag

DBGET integrated database retrieval system