KEGG   Anabaena cylindrica: Anacy_2658Help
Entry
Anacy_2658        CDS       T02435                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
acy  Anabaena cylindrica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Anacy_2658
Enzymes [BR:acy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Anacy_2658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3024130..3025638)
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPSSFPSRFGIGDLGLEAYRFIDFLKNSYQQYWQVLPLGPTGYGNSPYM
CYSAMAGNYFLISLEKLVDEGFLAEADFANLPEFPTDKVDFEQAIPIKVNLLKKACENFK
TQATAIQRKAFHHFCNTKGYWLDNYALFMALKDARNGASWHTWEPQLARREPAALSQIER
ELTDEIFYYKFVEYEFFRQWSELKNYANQNGIDIIGDIPIYVAHDSADVWANPDNFALDE
ETGEAALMAGVPPDYFSATGQLWGNPVYNWEELQKQDFKWWVQRFEAMLDYVDIIRIDHF
RGFEAYWAVPQGEETAVNGEWIEAPGVAFFEVIKQKLGKLPILAEDLGIITPEVEALRDQ
FEFPGMKVLHFAFGSDPGNPFLPFNYPRNAVVYTGTHDNDTTVGWFNSANDYEKQNLLLY
LGSISPDGINWDLIRLALSSIANQAIIPLQDVLGLGTQARMNYPSTAEGNWGWRYQAGVL
SGELCDRLQNLTKLYGRAPSNS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcctagatcaagcggtattttgttacatccaagttcctttcccagccgtttt
ggtattggggatttaggtttagaagcttatcgttttattgattttctcaaaaatagttat
cagcaatattggcaagttttacctcttggccccactgggtacggtaattctccttatatg
tgctactcagcaatggcaggaaattactttttgattagtctagaaaaactggtagatgag
ggttttttagctgaagctgattttgctaatttaccagaatttccgacagataaggtagat
tttgagcaagctatccctattaaagttaatctgctcaaaaaagcttgcgagaattttaaa
actcaagcaactgctatccaacgcaaagcatttcatcatttctgtaacaccaaaggctat
tggctcgataattatgccttatttatggcgcttaaagatgcccgaaatggtgcaagttgg
catacttgggaaccacaactggcaagaagagaaccagcagcattatcccaaatagaacga
gaactcacagatgaaatattttattacaaattcgttgaatatgagtttttccgtcagtgg
tcagaattgaagaattatgccaatcaaaatggcatagatattattggtgatatccccatt
tatgtagctcatgatagtgctgatgtgtgggcaaatcccgataattttgctctagatgaa
gaaacaggtgaagcggctttaatggcgggtgtaccacctgattattttagcgctacgggt
caattatggggcaacccggtttacaactgggaggagttgcaaaagcaagactttaagtgg
tgggtgcaacgctttgaagcaatgctagattatgtagatataattcgcattgaccatttc
cggggttttgaggcttattgggctgtacctcaaggggaagaaactgctgttaatggtgaa
tggattgaagctcctggagttgctttttttgaagttattaaacagaagttgggtaagttg
cccattttggcagaagatttggggattattacaccggaagtggaagcactgcgagatcag
tttgagtttcctgggatgaaggtgttacattttgcttttggttctgaccctggtaatccg
tttttaccttttaattaccccagaaatgctgtagtttatactggtactcatgataatgat
acgactgtaggctggtttaatagtgccaatgattacgaaaagcaaaatttgttgctttat
ttgggatctattagtcctgatgggataaactgggatttaattcgattagctctgagttcc
atcgctaatcaagcgattattcctttacaggatgttttaggactagggactcaagccaga
atgaattatcctagtactgctgagggtaattggggttggcgctatcaggctggggttttg
agtggggaattgtgcgatcgcttgcaaaatcttaccaaactctatggccgcgctccgagt
aattcctaa

DBGET integrated database retrieval system