KEGG   Anabaena cylindrica: Anacy_3276Help
Entry
Anacy_3276        CDS       T02435                                 

Definition
Glutathione S-transferase domain protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
acy  Anabaena cylindrica
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:acy00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3742811..3743533)
Genome map
AA seq 240 aa AA seqDB search
MRCRRIDICLIHDTVESQTLRETIMSLTFYFAPMSTASITECVLAELAIPFDLVKLNISV
GDTRTPEFLEVNPNGRVPVIVHEGTAIWESSAITMYLGEVFGVEAKLYPAPGPKRGEAMK
WIAWSNVTFAEAASRLFASLPTEKQGDAETNAQEKVAPEMKSAIAMEKAKADLADYLRIL
NGGLEGRSFLIGDYSLADTHLQGIVGWVGSMEVDLTPFPNITGWLKRCYERPAITKLMLG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcagaaggatagatatatgcttgattcacgatacagttgaaagtcaaacccta
agagaaacaatcatgagtcttacattttatttcgctcccatgtccacggctagcatcact
gaatgcgttctcgcagaacttgctattccattcgatctcgtaaaactcaatatcagtgtt
ggtgacactagaacgcctgaattcttggaggttaacccaaacggaagagtccctgtaatc
gtgcatgaaggaacagcgatctgggagtcttctgcgatcacgatgtaccttggtgaagtc
tttggcgtagaggcaaagctttatcctgccccaggaccaaagcgtggcgaagccatgaaa
tggatcgcatggagtaacgttacttttgccgaggcggctagcagattatttgcatccttg
cctactgaaaagcagggagatgctgaaactaacgcgcaggaaaaagtagcccctgagatg
aaaagtgcgatcgcgatggagaaagcaaaagcggatcttgctgattatctcagaattctc
aacggtgggttggaaggacgctcctttttaatcggtgactatagcctcgcagacactcat
ctgcaaggcatcgttggctgggtcggttcaatggaagtcgatctgactcctttccccaac
atcacaggatggctgaaacgctgctacgagcgtcctgcgattactaagttgatgctaggc
tga

DBGET integrated database retrieval system