KEGG   Anabaena cylindrica: Anacy_3503Help
Entry
Anacy_3503        CDS       T02435                                 

Definition
signal transduction histidine kinase with CheB and CheR activity (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
acy  Anabaena cylindrica
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:acy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Anacy_3503
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Anacy_3503
Enzymes [BR:acy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Anacy_3503
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Anacy_3503
Two-component system [BR:acy02022]
 CheA family
  CheA-CheYBV
   Anacy_3503
Bacterial motility proteins [BR:acy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Anacy_3503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3983992..3988215)
Genome map
AA seq 1407 aa AA seqDB search
MNDKKSSEPTQSDTKAVEVGEEKQQTQSYKPFPIVGIIASAGGLEAFTELLENLPINTGM
AFVLIQHLEPNHQSLLTEILAKTTQMPVHESYSGIVIEPNQVYIIPPNVKMTLEQGILKL
VPREKVEGRYRPGDAFLNSLAAEQGNKAISVVLSGSDADGTMGTQAIKAAGGITFAQSET
SAQFREMPNIAVATGHVDFILSPEEIAEELAKIALHPNFTRSNLSPTVEPPIESQDALLQ
VFALLQGASGVDFSRYKQTTLKRRIDRRMMLYNLERLEDYVEYLQNHPAEVQALYHEILI
NVTSFFRDSNAYQALKERVFPSIVKGKSVQSPIRIWVTGCATGQEVYSIAICLLEFLEDV
ISKPAIQIFATDINEIGIEKARSGIYKQNEITDISPERLRRFFVEVDGGYQINKSLREHC
IFARQNLISDPPFSNLDLITCRNLLIYLDSGLQKQLMTIFHYSLKPTGFLMLGNSESAGE
FSDLFALVDRKNKIYSKKLVPTNLNFNFSRGNYPVARVNLDKKMSEKSWDIDDLHKEADQ
LVLNRYAPVGVLISDNMEVLQFRGDTSYYLRPAPGQPSFNLLKMARKGLLEELRTAIHQS
KRLDVSVRKENLQIDGSESPKKVNFEVIPVKLPLAVNTRYFLVLFEDVPSLAEQTFLKPE
NQEQGNIVSEIVQFKQELLAAKQELALTQEYLESMIQEQEATTQDLKVANEEILSSNEEL
QSTNEELQTAKEEVQATNEELKTTNDELQSRNLELHHVNNDLLNLLSSVNIPILILANDL
RIRRFTPTAQHLLNLIPTDVGRPFSDIRSTINVVNLESLLLEVIDTLNVKELEVQDQQGH
WYNLRIRPYRTTSNQIDGVVMVLMDIDDIKCSAQQLEQSRNYAEAIVETVPQPLVVIDSS
LRVITANHAFYQTFQISSAQAEQQLICELGNGQWNIPNLITLLEEIFLKNTRLHDFEVEK
VFEKIGYRIMLLNGCKITQQDNEPMILLAIQDITQQKQFAAERAQLLAQEKSARLQAEVS
NRAKDEFLSILSHELRNPLNAILGWSQLLRTQNLKADQISQGLEVIERCARAQTQLIEDL
LDISRITTGKLHLNNSLIDLVSVIGSALEVVRLSAGAKNIEIIARLQPGIGKVLGDLDRL
QQILWNLLSNAVKFTSEGGRVEVTLERVDSQAEIRVSDTGIGIANDFLPYVFERFRQADS
TKTRAYNGIGLGLSIVRYLIELHGGTVYAESPGEGLGSTIIVRLPLSATIQEKYFPGDTE
KFPLAEGLESSVDGLPSLKGLRILVVDDEADMRELLMIILEDYGAQVTTAKSAQDALSIL
TSNPGIYDLLISDIGMMNEDGYSLIRQVRSLSAEAGGQIPAAALTGYVRDEECREAYLAG
FQMHMAKPIQLNQLVIMVANLAGRGGV
NT seq 4224 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataaaaagtcttctgagccaacccaatctgataccaaagctgtcgaagtcggg
gaagaaaaacaacaaactcaaagctataaaccatttccaattgtggggattatagcatct
gcgggaggattagaagcattcaccgaactgctggagaatttaccaattaatacaggaatg
gcatttgtactgattcagcacttagaaccgaatcatcagagcctactgactgaaattcta
gctaagaccactcagatgcccgtccatgaatcgtactctggcatagtcatagaaccgaac
caagtctatattatccccccgaatgtgaaaatgaccctggaacaagggatattaaaactc
gtaccccgtgagaaagttgaagggagatacagaccaggtgatgcctttttaaattcatta
gcagcagagcaaggaaacaaagcaattagtgttgtcctatctggaagtgatgcagacggc
acaatgggaacacaggcgattaaggcagcaggtggtattacctttgctcagtctgaaaca
tctgctcaattccgggaaatgccgaacattgccgttgctacaggtcatgttgacttcatt
ttgtcaccagaagaaattgctgaagaactagcaaaaattgctcttcatcctaactttacc
cggtcaaatctttcaccaacagttgagccacctatagaaagtcaggatgccttgcttcaa
gtctttgctttactgcaaggtgccagcggggttgactttagccgctacaagcaaaccaca
ttaaaacggcggattgatcgacggatgatgctgtacaatctggaaaggctggaggattac
gtcgagtatctccaaaaccatccggccgaagtacaggctttataccacgaaattctcatc
aatgtcaccagtttttttcgggacagtaatgcttaccaagccttaaaggagagagtattt
ccgagtattgttaaaggtaagtcagtacagtcgccaattcggatctgggtgacaggatgt
gccactggtcaggaagtttactcgattgccatctgcttattagagtttttggaagatgtc
atctccaaacctgctatccaaatttttgcgacagatattaatgaaataggaatcgaaaaa
gccaggtcaggtatttataagcagaacgaaataactgatatttcaccagaacggctcaga
cgcttttttgttgaagtggacggtggatatcaaatcaacaaatcacttcgtgaacattgt
atctttgctagacaaaacttgatcagtgacccaccattctctaatctagatctgattact
tgtcggaatttgctgatttatttagactccggtttacaaaagcagttgatgacaattttc
cattacagtctcaaacccacagggtttctgatgttaggtaattcagagagtgcgggagaa
ttctcagacttatttgccttagtagatagaaaaaacaagatttattctaagaaattagta
cctactaacctgaattttaacttttccaggggtaactatcccgtagcgagagtaaacctt
gacaaaaaaatgagtgagaagtcttgggatattgatgatttacacaaagaagctgaccaa
cttgtcttaaatcgttatgccccagttggtgttttgatcagcgacaatatggaagttctc
caatttcgcggagataccagttattatttaagacccgctccaggtcagcccagctttaat
ttactgaaaatggctcgaaagggcttactagaagagttgcgtaccgcaattcatcaatcc
aaaaggctggatgtttccgtaagaaaggaaaatttacagattgatggcagtgaatcgccc
aagaaagtcaattttgaggtgattccagtcaaacttcccttagcagtaaacactcgctac
tttctggtcttatttgaagatgtaccttcattagcagaacaaacttttctaaaacctgaa
aatcaagaacagggaaacatagtttcggaaatagttcaattcaaacaggaattgttagcc
gctaaacaggaacttgctctgactcaagagtatttagaatcaatgattcaggagcaggaa
gccacaactcaagacttgaaagtggcaaatgaagaaatcctgtcaagcaacgaggaacta
caaagcactaatgaggagttgcaaacagcaaaagaagaagttcaagcaactaatgaagaa
ctgaaaacaaccaacgatgaactgcaaagtcgaaatctagaattacaccatgtcaacaat
gatctgttgaatttgcttagtagtgtgaatattccgattttaatcttggcaaatgatttg
cggattcggcgcttcactcccacagcacagcatctcctcaatttgattcctacagatgtg
gggcgaccatttagtgatattcgctctacaatcaatgttgttaatttagagtcattgcta
ttagaagtaattgacactttgaatgtcaaagaactagaggtacaagatcagcaagggcat
tggtataatctgcgaattcgaccttacaggacgacaagtaatcaaattgatggcgtggtg
atggtattgatggatattgatgacattaagtgcagcgcccagcagctagaacagtcgcgt
aattatgccgaagccattgtggaaactgtaccacaacctttagtggtgattgattctagt
ttacgagttattacagccaatcacgctttttatcaaaccttccaaatttcctcagcgcaa
gcagaacagcaactgatatgcgaactaggaaatggtcaatggaacattcccaatctaatc
acgcttctagaagaaattttcctgaaaaatactcggcttcacgactttgaggtagagaaa
gtctttgagaaaattgggtacagaattatgctgctcaatggttgtaaaattactcaacaa
gataatgaaccgatgattttgttggcaattcaggatatcacgcagcagaagcagttcgcg
gcagaacgcgctcagttactggctcaggagaagtcagcccgcttgcaagcagaggtatct
aaccgcgctaaagatgagtttttatctattctctcccatgaactccgcaatccgctgaat
gccattttgggatggtctcagttactccgcacgcaaaatctgaaggcagatcaaatctct
caaggacttgaagtcattgagcgctgcgctagggcgcaaactcaactaattgaggatctt
ctagacatctcccgcattacgactggcaaactccatctcaacaatagcctcattgatctc
gtttctgtaattggttcagcccttgaagttgtacggttgtccgcaggagctaaaaatatt
gagatcatagctcgtttgcaacctggaattggaaaagtactgggtgatttagaccgcttg
caacagatactctggaatttgctttctaatgctgttaaatttacctctgaggggggacgt
gttgaagtcactttggaacgtgttgattcccaagccgagattcgagttagtgacacaggt
attgggatagctaatgactttctcccttatgtttttgagcgttttcgtcaggctgatagc
accaaaactcgcgcctataatggaattgggttgggattatcaattgtccgttatttgatt
gaacttcatggtggtacggtttatgcagaaagtccaggtgaggggctaggatcaaccata
atcgttaggctaccgctttctgccacgattcaggaaaaatattttcctggtgatactgag
aagttcccattagcagaaggtttggaatcatccgttgatggtctgccgtcactgaaaggt
ttgcgtatactcgttgtagatgatgaggcagatatgcgtgaattactgatgataatactg
gaggattatggggcccaggtaacgacggccaaatctgctcaagacgcgctctcaatattg
acaagcaaccctgggatatatgatttgctaatatctgatattggcatgatgaacgaggat
ggctatagtttaatccggcaggtgcgatcgcttagtgctgaggccggaggacaaattccc
gcagcagctttgacagggtatgttcgtgatgaggaatgccgagaagcttatttggcaggt
ttccaaatgcacatggctaaacccattcagctaaatcaactggtaatcatggttgcgaat
ctagctggacgaggtggtgtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system