KEGG   Anabaena cylindrica: Anacy_3542Help
Entry
Anacy_3542        CDS       T02435                                 

Definition
Glutathione S-transferase domain protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
acy  Anabaena cylindrica
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Anacy_3542
Enzymes [BR:acy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Anacy_3542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4033704..4034264
Genome map
AA seq 186 aa AA seqDB search
MLKLYGSTFSRASIVQWYLEELEVPYEFVLLDMKAGEHRQPEYLAINPIGKVPAIVDGDF
QLWESGAILLYLAEKYGNKPLSLEERAIISQWVLFGNSSLATGIFVEANREREMPRLLTS
LNEILEQQPFLLGNEFTAADVAVGSILAYIPIMLKLDLSAYSAVLKYIQQINERPAFQKS
IGAGRS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaactttacggtagcacttttagtcgtgcatccattgttcaatggtatttagaa
gaactagaagttccctatgagtttgtcctgctggatatgaaagcaggtgaacaccgacag
cctgaatacctagcaattaaccccataggtaaagtaccagcaattgttgatggtgatttt
caactgtgggaatctggggcaattttgttgtatcttgccgaaaagtatggcaataaacca
ttatcactagaggaacgcgccataatttctcagtgggtattatttggcaattccagtttg
gctacaggaatttttgtggaagctaatcgggagagggaaatgccccgcttgttaacttcc
ctaaatgaaatattagaacaacaaccttttttgctaggtaatgaatttactgctgctgat
gtggctgtgggatctatactcgcctatattcccatcatgttgaagctagatttgagtgcc
tactcagcggtgttgaagtatattcagcaaataaatgaacgccctgcttttcaaaaaagt
atcggtgcaggacgtagttag

DBGET integrated database retrieval system