KEGG   Anabaena cylindrica: Anacy_3735Help
Entry
Anacy_3735        CDS       T02435                                 

Definition
cobaltochelatase CobN subunit (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
acy  Anabaena cylindrica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:acy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4263672..4267406
Genome map
AA seq 1244 aa AA seqDB search
MKRIVLIAGFESFNADLYRDAAFLANSRVKELDIRVFSDRDITTKRNEVKAALQGADVFF
GSLIFDYDEVLWLREQIANIPIRLIFESALELMSLTKIGEFAIGDQPKGMPKPVKFILDK
FSNGKEEDKLAGYISFLKIGPKLLKFVPVQKVQDLRNWLIIYGYWNAGGSENVASLFLTL
AERYLDLRVGDIPPPIETPNMGLLHPDYQGFFTSPKAYLEWYQRGSQESGVRSQEKERNK
ITQSPIIGILLYRKHVITKLPYILQLIRKFEEAGLTPLPIFINGVEGHVAVRDWMTTDYE
TQQRQLGNIETPSLSPEAVKVDAVVSTIGFPLVGGPAGSMEAGRQVEVAKRILTAKNVPY
IVAAPLLIQDIYSWVRQGVGGLQSVVLYALPELDGAIDTIPLGGLVGEQIYLVPERVQRL
INRVKSWVSLRQKSISERKIAIILYGFPPGYGAVGTAALLNVPRSLIKLLHALKEQGYTV
GDIPEDGEELIRQIKEADENPNPTLPTSGEEVMSGGARGGSTVNARTLEKWLGYLQTSRI
EKQWKYLTGSGIKTYGDEFNIGGVQLGNVWIGVQPPLGIQGDPMRLMFERDLTPHPQYAA
YYKWLQNEFKADAVVHFGMHGTVEWLPGSPLGNTGYSWSDILLGNLPNLYIYAANNPSES
ILAKRRGYGVLISHNVPPYGRAGLYKELVNLRDLIAEYREDPGKNYLLKEGICKKIVDTG
LEVDCPFDDAKRLGISFTPENVRMFSNHAFDHYLVKLYEYLQVLENRLFSSGLHTLGEAP
NQEELAGYLDAYFGGENEPQRHREHREEEERVITDLLNQSTDELTNLLRGLNGEFIPPAP
GGDLLRDGAGVLPTGRNIHALDPYRMPSPAAFERGREIAKKIISQHSNDNQNYPETVAVL
LWGLDAIKTKGESLGILLELVGAEPVKEGTGRIVRYDLKPLDQVGHPRIDVLANLSGIFR
DSFVNIIELLDDLFQRAADADEPEEMNFIRKHALALKAQGVENSSARLFSNPSGDFGSLV
NDRVVDGNWESGEELGDTWESRNVFSYGRQDKGQARPEVLQTLLKTSDRIVQEIDSVEYG
LTDIQEYYANTGGLKKAAEKQSGRKVQASFVESFSKDTTPRNLDDLLRMEYRTKLLNPKW
ADAMANQGSGGAFEISQRMTALIGWGGTADFRDDWVYDQAAETYALDAEMAEKLRKANPE
AFRNIVGRMLEASGRSLWQADQEKLDKLRKLYDLTDEELEGVTV
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcgtcttgattgcaggctttgaatcatttaacgctgacttataccgggat
gcggcttttttggcgaattcgcgggtgaaagagttggatattcgggtgtttagcgatcgc
gatattaccactaagcgcaacgaagtaaaagccgcactccaaggtgcagatgtgtttttc
ggcagcttaatctttgactacgacgaagttttatggttacgggaacagatcgctaacatc
cctatcaggcttatttttgagtcagcactggagttgatgagtttaacaaaaataggagaa
tttgcgatcggtgatcaaccgaaaggaatgccaaaacccgttaaattcatccttgacaaa
ttcagcaatggtaaagaagaagacaaactcgcaggttatatcagcttcctcaaaatcggc
cccaaactcctcaaattcgtacccgtccaaaaagtccaagacttacgtaactggttaatt
atctacggttactggaatgcaggtggttcagaaaatgtcgcctctctatttttaacactt
gcggaaagatacttagatttaagagtcggtgacatccccccacccatcgaaacccccaat
atggggttattacatcccgactatcaagggttttttacatcgcccaaagcatacttagaa
tggtatcaaagagggagtcaggagtcaggagtcaggagtcaggagaaagaaaggaataaa
attacccagtccccaattattggtattttactttaccgaaagcacgttattaccaaatta
ccctatattctccaactgattcgtaaatttgaggaagcgggtttaacacctttacccatc
tttatcaacggtgtagaaggacacgtagccgtccgtgattggatgacaaccgactacgaa
acccaacaacgtcaactcggtaacattgaaaccccttccctttccccagaagccgtgaaa
gtagatgctgtagtttctactatcggatttcccttagttggtggccccgctggttcaatg
gaagcaggaagacaggtagaagttgctaaacgcattctcacagctaaaaatgttccttat
attgtcgctgcacctttattaattcaagatatttattcttgggtacgtcaaggggttggt
ggtttacaaagtgtggttttatatgctttaccagaattagacggggcaattgatactatt
ccattgggtggtttagtaggtgaacaaatttatttagttcccgaacgagttcagcgttta
attaatagagtcaaaagctgggtttcactgcgacaaaaatccatttcagaacgcaaaata
gcaattattttatatggcttccctcccggttatggtgcagtgggaacggctgcattatta
aatgttcctcgcagtttaattaaattacttcatgccctgaaagaacaaggttatacagtt
ggtgacattcctgaagatggggaagaattaattcgccaaattaaagaagcagatgaaaac
cccaacccaaccctccccacaagcggagaggaagtcatgtccgggggggctagggggggt
tctactgtcaatgctagaacattagaaaaatggttaggatatctccaaacatccagaatt
gaaaaacaatggaaatatctcacaggtagcggtattaaaacctatggagatgagtttaat
attggaggtgtacagttaggaaatgtgtggataggtgtccaaccaccgttaggaattcaa
ggcgaccccatgcggttaatgtttgaaagagatttaacgcctcatccccaatatgcagct
tattataaatggttacaaaatgaatttaaagctgatgcggttgttcattttggaatgcac
ggaactgtggaatggttgcccggttcacctttaggaaatactggttattcttggtctgat
attctcttaggaaatctgcccaatctatatatctatgctgctaataatccttcggaatca
attttagctaaacgtcgcggttatggggtgttaatttctcacaatgtcccgccttatgga
cgcgctggtttatataaggaattagtaaatttacgagatttaattgctgaatatcgggaa
gatccaggaaagaattatttgttaaaggaagggatttgtaagaaaattgttgatactggt
ttggaggtggattgtccttttgatgatgcgaaaaggttggggatttcatttacaccggaa
aatgtgaggatgtttagtaatcatgcttttgaccattatttggtgaagttgtatgaatat
ctgcaagttctcgaaaatcgtcttttttcttctgggttacatactctaggtgaagcaccg
aatcaggaggagttagctggttatttggatgcttattttgggggagaaaacgaaccacag
agacacagagaacacagagaggaagaagaacgagtaattacagatttattaaatcaatct
actgatgagttaacgaatcttttgcgtggtttgaatggtgagtttattcctcctgcacct
ggtggtgatttgttaagggatggtgctggtgttttacctacgggtagaaatattcatgct
ttagatccttatcgtatgccttctcctgctgcttttgaacggggtagagaaattgctaag
aaaattatttctcaacattcaaatgataatcagaattatcctgaaactgtggcagttttg
ttatggggtttggatgcgattaaaactaagggtgaatctttaggaattttgttggaattg
gtgggtgctgaacctgtgaaggaaggaacgggaagaatagttagatatgatttgaaacct
cttgatcaagttggtcatccacgtattgatgtgttagcaaatctatcgggtatttttcga
gatagttttgtgaatattattgagttgttagatgatttatttcaacgtgctgctgatgct
gatgaaccggaggaaatgaattttatcagaaaacacgctttggctttgaaagcgcaaggt
gtggaaaattcttcagcgaggttgttttctaatccatctggtgattttggttctttggtt
aatgatagagttgtcgatggtaattgggagtcgggggaagagttgggggatacttgggaa
agccgcaatgtgtttagctatggtagacaggataagggacaagctaggccggaagtattg
cagactttattaaaaacaagcgatcgcattgttcaagaaatagattcggtagaatatggt
ttaactgatattcaggaatattatgcgaatacaggcggtttaaaaaaagccgcagaaaaa
caaagtggtaggaaggtacaagccagttttgtggaaagtttctctaaagacaccacaccc
cgcaatttggatgatttgttgcgaatggaatacagaaccaagctgctaaaccccaaatgg
gctgacgcaatggctaatcaaggttctggtggcgcttttgaaatctctcaacgcatgaca
gctttaatcggttggggtggtactgctgattttcgagatgattgggtttatgaccaagcc
gcagaaacctatgctttagatgcagaaatggcagaaaaattacgcaaagcaaatcctgaa
gcttttagaaatatagtggggagaatgttagaagcatcaggacgcagtttgtggcaagct
gatcaagagaagttggataaactgcggaaattgtatgatttaactgatgaagaattggaa
ggagtaacggtgtaa

DBGET integrated database retrieval system