KEGG   Anabaena cylindrica: Anacy_4151Help
Entry
Anacy_4151        CDS       T02435                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
acy  Anabaena cylindrica
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:acy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:acy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4673075..4674070
Genome map
AA seq 331 aa AA seqDB search
MPSTTWNRHHILSLADFTTFEYNAVLQTAASFQEVLSRRTKKVPTLQGQVVANLFFESST
RTRSSFEIAAKRLSADTLNFAAATSSMTKGETILDTAKTYLAMGTDIMVIRHREAGVPQA
IAQEMDRLGVKVSVLNAGDGQHEHPSQGLLDLFTICTLIDPAQPRIELLQGKKIALVGDI
LHSRVARSNIWSLIASGAEVHLAAPPTLLPKFFSEYLGEAANTGKLFTHWQIEPALENAD
YVMTLRLQKERMTAHLLPSLREYHQLFGITRAKLKLCKPNVKVLHPGPVNRGVEISSDLM
DDPEFSLIQSQVTSGVAVRMALLYFIGSGRA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtactacctggaatcgtcatcacattctttccctggctgacttcacaactttt
gaatataacgcggttttgcaaactgcggcctcatttcaagaggtactatcacggagaaca
aaaaaagtacctaccttacagggacaggtggtggccaatctattttttgaatcctctacc
cgcacacgcagtagttttgaaattgctgctaaacgtttaagtgcggataccctcaacttt
gcagctgcgacttcttccatgacaaagggagagacaattctcgacacagcgaagacctat
ttggcgatgggaactgatattatggtgattcgccatcgagaagcgggagttccacaagcg
atcgctcaagaaatggatcgtttaggtgtcaaagtcagtgtcctcaacgccggtgatggt
caacacgagcatccttcccaaggattacttgacttatttaccatttgtacattaattgat
ccagcccaaccccgcatcgaactattacaaggtaaaaaaatagctcttgttggcgatatt
ctccattctcgcgtagcgcgttctaatatttggagtttaattgccagtggtgctgaagtt
catcttgcagcaccgccaacattattacctaaattctttagtgaatatttaggtgaagca
gcaaacacaggcaagttattcacccattggcaaatagaaccagctttagaaaatgccgat
tatgtcatgacattgcggttacaaaaagagcgcatgacggctcatttattgccaagtttg
cgagaatatcatcaactatttggtattactcgcgccaaactcaaactgtgtaaacctaat
gttaaagttttacatccaggcccagttaatcggggtgtagaaattagctctgacttaatg
gatgatcctgaatttagcttaattcaatcacaagttaccagtggcgtagccgtgcgaatg
gcgttgttgtattttattggtagtggtagagcctga

DBGET integrated database retrieval system