KEGG   Anabaena cylindrica: Anacy_4197Help
Entry
Anacy_4197        CDS       T02435                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
acy  Anabaena cylindrica
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:acy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:acy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4729322..4730011
Genome map
AA seq 229 aa AA seqDB search
MINDVIFVYPISNGYSHKLKIMILRSEFTNNYQIPDLTHAGFDIVALAASAGGLTAITEV
LSALPTDFKAAIVIVQHLDPKSRSLMAEILRRHIVLDVKQAEDGDKLNPGMVYIAPPNHH
LLVNCDATLSLSQSEKVHFLRPAADVLFKSVAGSYKDRAIAVVLTGNGCDGAIGVKAIHK
MGGIIIVEDEKTAEFKGMPLAAIETGNVDFIIPKEGISSALINLVMARG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgatgtcatatttgtttatcctattagtaacgggtatagtcataaattaaaa
atcatgattttgcggtcagaatttaccaataattatcaaattcctgacttgactcatgct
ggcttcgatattgtggctctggcagcttctgcgggtggtttaacagccataactgaagtt
ttatcagctttaccgactgattttaaagcggcaattgtgatagtccaacatcttgatcct
aaatctcgctcattaatggcagaaattctccgtcgtcatattgttctcgatgtgaaacag
gcagaggatggagataaactgaacccaggaatggtttatatagctcctcctaaccatcat
ttgttggttaactgtgatgctacgctttctttatctcagtcggaaaaggtgcattttctg
cgtcctgctgctgatgttttatttaaatcggtagcaggtagttacaaagatagagcgatc
gctgttgtattaactggaaacggctgtgatggtgcaataggagtaaaagctattcacaaa
atgggtgggatcatcattgttgaagatgaaaaaactgctgaatttaaagggatgccttta
gctgctattgaaactggtaatgtggactttatcatccctaaggaaggtatctcttcagcc
ttgatcaatttggttatggctcgtggttaa

DBGET integrated database retrieval system