KEGG   Anabaena cylindrica: Anacy_4328Help
Entry
Anacy_4328        CDS       T02435                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
acy  Anabaena cylindrica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Anacy_4328
Enzymes [BR:acy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Anacy_4328
Exosome [BR:acy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Anacy_4328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4889994..4891655
Genome map
AA seq 553 aa AA seqDB search
MAKSIEFKLFAPYNKGVALMGSFSNWQEIPMEKGKDGYFRTNVQLADGSYSYKFRVQSNS
WFFEPGQWVDVTDPYATNIDEMGGKDDGMIRIKDGEIITDTYVWRHDDKHLSPDHELVIY
EMHVGDFSGGEDDPYARGKYKHVVEKLDYLCELGINAIELMPIKEYPGSYSWGYNPRHFF
ATESSYGSTTDLKNMIDECHARGIRVIMDGIFNHSEASSPLTQIDHDYWYHHSPRDPENN
WGPEFNYEHYDKNLDIYPARKFIGDTIRFWIEQYHIDGIRYDAARQIANYDFMHWIVQEN
RNAAGVKPFYNIAEHIPETPSITNQDGPMDGCWHDSFRHTITVHICGDVFELENLKDVID
CKRQGFMGTTNVVNYLTNHDHDHLMVELANRDIFDEEAVKRAKLGAAILMTSVGVPLIWM
GEEFGEYKPKQSSASKIDWNLLGNDLNRSLFDYYKGLINLRKTNHALYTENIDFIHENPE
TKVLAYSRWNDEGSRVVVVANFSNDFLAGYQITNFPSSGTWHEWTGNYDIEAGENTIMTD
LGSYEAKVFVWHK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtcaattgaatttaaattatttgctccctacaacaaaggagtagccttaatg
gggtctttttctaattggcaagaaataccaatggaaaaagggaaagatggatattttcgg
acaaacgtacaattagcagacggaagttatagctataaatttcgagttcaatcaaactcc
tggttttttgaaccaggacagtgggttgatgtcacagatccttatgccacaaacattgat
gagatgggtggaaaagatgatggtatgatcagaataaaagatggggaaattattactgat
acatatgtttggagacatgatgataaacatttatcaccagatcatgaattagtaatttat
gaaatgcacgttggggacttttctggtggagaagatgatccttatgcaagaggaaaatat
aaacacgtagtcgaaaaactagattacctctgtgaattaggaatcaatgcaattgagtta
atgcctataaaagaatatcctggtagttatagttggggttataatccccgtcacttcttt
gccacagaatctagttatggttctacaacagatttaaaaaatatgatagacgagtgtcat
gccagaggcattcgtgtgattatggacggaattttcaaccactcagaagcatccagtccc
ctcacccaaatagaccatgactattggtatcatcactctcctcgtgatccagaaaataat
tggggtccagaatttaattacgaacattatgacaaaaatttagatatttatcctgccaga
aaatttattggtgatacaatccgtttttggattgaacaatatcatatagatggtattcgt
tatgatgccgctagacaaatcgccaactatgatttcatgcattggattgttcaggaaaat
cgaaatgctgctggtgttaagcctttttataacatcgctgaacatattccagaaactccc
agcatcactaatcaagatgggccaatggatggttgctggcatgatagtttccggcacaca
attacagtacatatttgcggtgatgtctttgaattagaaaatctcaaagatgttattgac
tgtaaacgtcaaggcttcatggggacaaccaatgttgttaattacttaactaatcatgac
catgatcatctgatggttgagttggctaatcgtgatatttttgacgaggaagctgtaaag
cgggctaaattaggagcagctattctcatgacatctgttggtgtacctttaatttggatg
ggtgaagaatttggtgaatataaacctaaacaatcttccgcatcaaaaattgattggaat
ttgctaggtaatgacctaaatcgcagcttgtttgattactataaaggcttgattaatttg
cgtaaaactaatcatgcactatacacagaaaacattgattttatccacgaaaatccagaa
acaaaagttctcgcttatagtcgatggaatgatgaaggttctcgtgtagtagtagtagcc
aatttctctaatgacttcttagctggctaccaaattactaattttccctctagtggtaca
tggcatgaatggacaggtaattatgatatagaagcaggtgaaaatactattatgacagac
ttaggctcttatgaagccaaagtatttgtctggcacaaatga

DBGET integrated database retrieval system