KEGG   Anabaena cylindrica: Anacy_4434Help
Entry
Anacy_4434        CDS       T02435                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
acy  Anabaena cylindrica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Anacy_4434
Enzymes [BR:acy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Anacy_4434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5017134..5017772
Genome map
AA seq 212 aa AA seqDB search
MISYLKGIVAGVQTISANRVILTLEVNGLGYDLQIPQRLANQLTSTGDVVQIFTHYQIRE
EVPLLYGFSSPSERDLFRHLLSVSGIGAALAIALLDTLELPELVQAIIAANTQILIQTPG
VGKKTAERLCLELKSKLIEWRKSAGFFVATGGPAPGILEEVQMTLFALGYTAHEVSHALH
VVSENIGLPKDAYVEDWIKQAIAHLSSTEAGV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgattagttatcttaaaggtatcgttgctggtgtccaaacaattagcgctaatcgcgtc
attttgacattagaggtaaatgggttgggttacgatttgcaaattccacagcgtctagct
aaccaattaacaagtactggagatgtggtacaaatatttacccattaccagattcgggaa
gaagtacctttactctatggtttttcttcgccatcggaacgggatttatttcggcacttg
ctatctgtgagtggtattggtgcagctttagcgatcgcacttttggacactttggaatta
ccagagttagtccaagcgattattgcggctaacactcaaatactaattcaaactcctgga
gtgggtaagaaaaccgctgaaaggttatgtttagaactcaaaagcaagttgattgaatgg
cgcaaatcagcaggcttcttcgtggctacaggtggccctgcaccgggaatccttgaagaa
gtgcaaatgactctcttcgctttgggatatactgcccatgaagtcagtcacgctctgcac
gtagtcagcgaaaatattggtttacccaaagatgcctatgtggaagattggatcaaacaa
gcaatcgcccatcttagcagtaccgaagctggcgtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system