KEGG   Anabaena cylindrica: Anacy_4661Help
Entry
Anacy_4661        CDS       T02435                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
acy  Anabaena cylindrica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Anacy_4661
Enzymes [BR:acy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Anacy_4661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5286237..5288258
Genome map
AA seq 673 aa AA seqDB search
MPAPTITPKMTAFPLTAVVGQEAIKIALLLTAVDPALGGVVIAGRRGTAKSVMARAIHAL
LPPIEVVKDSLCNCDPNHPEEWDDKLLAEERQEIETEIIPAPFLQIPLGVTEDRLLGSVD
VEQSVKQGDTIFQPGLLATANRGVLYVDEINLLDDQISNQLLAVLSDGRNQIEREGISFQ
HPCKPLFIATYNPEEGALREHLLDRIAIALSADGVLGLDQRVQAVEQAIAYSKSPSEFLQ
QYSEDIDSLKTQIILAREWLKEVTITQEQITYLVNEAIRGGVEGHRAELFAVRVAKAAAA
LEGRNTVNAEDLRRAVELVIVPRTTIIQTPPPDQPPPPPPPPPENQDESESEEEQEEENE
EEKEEEQEQQEPPDIPEEFIFDPEGVILDPEVLYFTQMAQRQGKSGSRSIIFSDDRGRYI
KPMIPKGKARRIAVDATLRAAAPYQKARRARQPDKKVIVEQGDIRSKRLVRKAGALVVFV
VDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVSLIPFRGEQAEVLLPPTRSIALAKNRL
ERLPCGGGSPLAHGLTQAVRVGVNAQMGGDIGQVVIVAITDGRGNIPLARSLGEPIEPGE
KPDIKAELLDIAGRIRASGMQLLVIDTESKFVSTGFAKELSKAAGGKYYHLPKATDKAIA
AMTRGAIADMKSK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcctactattaccccgaaaatgactgcttttccgctgactgctgtagttggt
caagaagcgattaagatagccttgctgttgacagcagtagatcccgcgttggggggtgtg
gtaattgcaggtcgtcgtggtacggctaaatctgtgatggcgcgtgctattcacgctttg
ttaccacctattgaagttgttaaagattccctctgtaactgtgacccgaaccacccagaa
gaatgggatgataaacttttagccgaggaaagacaggagatagaaacggaaattattcct
gcaccttttttgcaaattcccctgggtgtgacggaagaccggcttttaggttctgtggat
gtggaacagtcggttaaacaaggtgatacaatttttcaaccggggttactggctaccgca
aatcgtggggtgctgtatgtggatgaaatcaatttattagatgaccaaattagtaaccaa
cttttagctgtattatctgacggacgtaaccagattgaacgggaagggatcagttttcaa
catccttgtaagccgttgtttattgcgacttataacccggaagaaggagcgttaagggag
catttacttgatagaattgcgatcgcactatcagcagacggagttctgggtttagatcaa
agagtacaagcagttgaacaagcgatcgcatattccaagtctccctcagaatttctccag
caatatagcgaagacatcgactcactcaaaacccaaatcatccttgcacgagaatggtta
aaagaagtcaccattactcaagaacaaattacctacctcgttaatgaagccattcgcggt
ggtgtggaaggacatcgcgcagaattatttgcggtacgagttgcaaaagccgcagcagct
ttagaaggacgcaataccgtaaatgctgaagatttacgtcgcgcagtagaattggtcata
gttcccagaacaaccataattcaaaccccaccaccagaccaaccacctccacctcctccc
ccaccaccagaaaatcaagacgagtcggaatcagaagaagaacaagaggaagaaaacgaa
gaagagaaagaagaggaacaagaacagcaagaacccccagacattcccgaagaatttatt
tttgatccagaaggggtaattcttgacccagaagtgctttattttacccaaatggcacaa
cgtcaaggtaaatctggaagccgcagtattatcttctcagacgaccgggggcgctatata
aagccgatgattcccaaaggtaaagctagacggatagccgtagatgccacacttcgagcc
gcagctccgtatcaaaaagcacggcgagctagacaaccagataaaaaggtgattgttgaa
cagggagatatccgttctaagcggttggtgagaaaagccggcgctttggtggtttttgtt
gtggatgcttctggttcaatggctttaaatagaatgcaatccgctaaaggtgcggtgatg
caacttttaacagaagcctatcaaaatcgtgaccaagtatctttaatacctttccggggt
gaacaagcagaagttttattacctcctacccgttcgattgctttagctaaaaatcgcttg
gaaagattaccttgtggtggtggttctccccttgcacatggtttaactcaagcggttcgt
gtgggtgtaaatgcccaaatgggtggggatatcggtcaagttgtgattgtggcaattact
gatggtcgtggtaatattcctctggctcgttctttaggagaacccatagaaccaggagaa
aagccagatattaaagccgaattattagatattgcaggcagaattcgggcttcggggatg
caattgttagtaattgatactgagagtaaatttgtatcaactggctttgcaaaggaattg
tcaaaagcagccggtggtaaatattatcacctaccgaaagcgactgataaagcgatcgcg
gctatgactagaggagctatagcagacatgaaatcaaagtaa

DBGET integrated database retrieval system