KEGG   Anabaena cylindrica: Anacy_5148Help
Entry
Anacy_5148        CDS       T02435                                 

Definition
(RefSeq) DNA replication and repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
acy  Anabaena cylindrica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Anacy_5148
DNA repair and recombination proteins [BR:acy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Anacy_5148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5832566..5833132
Genome map
AA seq 188 aa AA seqDB search
MEQLQRLPGVGPKSAQRLALHILKRPETEVEALAQAMIDAKKQIGLCQVCYHLSSEPVCE
ICRNPNRDNKIICVVADSRDVIALEKTREYKGKYHVLGGVISPMDGIGPEQLTVQPLVRR
VSQQKPQEVIMAISPSVEGETTTLYIGQLLKPFTKVTRIAFGLPVGGDLEYADEVTLARA
LEGRRELD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
attgagcaactgcaacgccttcccggagttggccccaaatctgcccagcgtctagcgttg
catattttgaaacgtccagagacagaagtagaagccttagcacaggccatgattgatgca
aaaaaacaaataggtttgtgtcaagtctgctatcacctctcatctgaacctgtatgtgaa
atttgtcgcaaccccaaccgagataataaaattatctgtgtagttgcagattcccgtgat
gtaattgcactagaaaaaacccgcgaatataaaggcaagtatcacgttttaggtggggta
atttccccaatggacggtattggcccggaacagttgacagtccaacctttagtgcggaga
gttagtcaacaaaagccgcaagaagtaattatggcaattagtcccagtgtggaaggggaa
acaacaacattatatataggtcagctactcaaaccatttaccaaagtcactcgtattgcc
tttggtctaccggtgggtggtgatttagaatatgctgatgaggtgacactggctagagct
ttagaaggtcggcgagaattagattag

DBGET integrated database retrieval system