KEGG   Anabaena cylindrica: Anacy_5148Help
Entry
Anacy_5148        CDS       T02435                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
acy  Anabaena cylindrica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:acy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5832566..5833132
Genome map
AA seq 188 aa AA seqDB search
MEQLQRLPGVGPKSAQRLALHILKRPETEVEALAQAMIDAKKQIGLCQVCYHLSSEPVCE
ICRNPNRDNKIICVVADSRDVIALEKTREYKGKYHVLGGVISPMDGIGPEQLTVQPLVRR
VSQQKPQEVIMAISPSVEGETTTLYIGQLLKPFTKVTRIAFGLPVGGDLEYADEVTLARA
LEGRRELD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
attgagcaactgcaacgccttcccggagttggccccaaatctgcccagcgtctagcgttg
catattttgaaacgtccagagacagaagtagaagccttagcacaggccatgattgatgca
aaaaaacaaataggtttgtgtcaagtctgctatcacctctcatctgaacctgtatgtgaa
atttgtcgcaaccccaaccgagataataaaattatctgtgtagttgcagattcccgtgat
gtaattgcactagaaaaaacccgcgaatataaaggcaagtatcacgttttaggtggggta
atttccccaatggacggtattggcccggaacagttgacagtccaacctttagtgcggaga
gttagtcaacaaaagccgcaagaagtaattatggcaattagtcccagtgtggaaggggaa
acaacaacattatatataggtcagctactcaaaccatttaccaaagtcactcgtattgcc
tttggtctaccggtgggtggtgatttagaatatgctgatgaggtgacactggctagagct
ttagaaggtcggcgagaattagattag

DBGET integrated database retrieval system