KEGG   Anabaena cylindrica: Anacy_5209Help
Entry
Anacy_5209        CDS       T02435                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
acy  Anabaena cylindrica
Pathway
acy00790  Folate biosynthesis
acy01100  Metabolic pathways
Module
acy_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Anacy_5209
Enzymes [BR:acy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Anacy_5209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFZ60539
UniProt: K9ZP17
Position
5899231..5899881
Genome map
AA seq 216 aa AA seqDB search
MTLSIRPDLNSAAQVVSSLSTQQQPIVTEAEMMQAVRTLLIGLGENPDREGLKDTPKRVV
KALQFLTKGYNESLDELLNGAVFTEDADEMVLVRDIDIFSSCEHHILPVIGRAHVAYIPD
GKVIGLSKIARICEMYARRLQVQERLTLQIADALQGLLKPKGVAVVIEATHMCMVMRGVQ
KPGSWTVTSAMRGVFSEDARTREEFMNLIRHNPNFH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactttatcgattcgtcccgatctgaattctgctgctcaggtagtgtcatctttatct
actcagcaacaaccaattgtgacagaagcagaaatgatgcaagctgtcagaactttgctg
attggactaggcgaaaatcctgaccgggaagggttaaaagatactcctaaaagagtcgtt
aaagccttgcagtttctcaccaaaggatataatgagtccttagatgaactgttaaatgga
gcagtctttacagaagacgctgatgaaatggtattagtccgggatattgatattttcagt
tcctgtgaacatcatatcttgccagttattggccgcgctcatgtcgcctatattcctgat
ggtaaagtcattggtttatcaaaaattgcccgcatttgtgaaatgtatgcaagacgttta
caagtacaagaacggttaactttacaaattgctgatgcactgcaaggtttactcaaaccc
aaaggggttgcagtggttatagaagcaactcatatgtgtatggtgatgcgcggtgtacaa
aaacccggttcttggactgtgactagtgcaatgcgtggtgtattctcagaagatgctcgc
acccgtgaagagtttatgaatttgattcgacacaatcctaattttcactaa

DBGET integrated database retrieval system