KEGG   Anabaena cylindrica: Anacy_5291Help
Entry
Anacy_5291        CDS       T02435                                 

Definition
uroporphyrin-III C-methyltransferase (EC:2.1.1.107)
Orthology
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
acy  Anabaena cylindrica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:acy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5992588..5993301
Genome map
AA seq 237 aa AA seqDB search
MTNNKVYLVGAGPGDLAYLTVKAYRLLASAQVLVYDALVDAQLLDCVPHDCLKLDVGKRG
GKPSTPQTEINNLLVKHCQEGKQVIRLKSGDPFIFGRCISEIEALKSAGCEFEVIPGISS
ALAAPLLAGIPLTDNVLSRCFAVLTAHEPDVLDWEALSRLETLVILMGGKNLAEIVYQLL
RHNLSHSTPIAIIRWAGTPSQEICIGELGNILEQTAGLSLSPAVIVIGEVVRLRQYL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataataaagtttaccttgtgggtgctggaccaggagatttggcatatttaact
gtcaaagcttatcgtcttttggcatctgcccaagtcttagtttatgatgctttagtagat
gctcaattgttagattgtgtcccacatgattgtctaaaattagatgttggtaaacgtggt
ggtaaacccagcactccccaaactgaaattaacaatttactagttaagcattgtcaagaa
ggtaaacaagttattcggctaaaatcaggagatccttttatttttggccgttgtatttct
gaaatagaagctttaaaatctgctggttgtgaatttgaagtgataccaggaatttcttca
gctttagcagcacctttacttgcaggaattcctctaacagataatgttctcagtcgttgt
tttgcggtattgacagcacatgaaccagacgttttagactgggaagcactatcaagatta
gaaactttggtaattttgatgggggggaaaaatttagcagaaatcgtttatcaactgcta
cgccataacctatcgcattccacaccaattgctattattcggtgggcaggaactcctagt
caagaaatctgcataggtgaattaggcaatattttggaacaaactgcgggtttatctctc
tctccagcagtaattgttattggtgaagttgtccggttacgtcaatatttgtag

DBGET integrated database retrieval system