KEGG   Anabaena cylindrica: Anacy_5292Help
Entry
Anacy_5292        CDS       T02435                                 

Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acy  Anabaena cylindrica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Anacy_5292
Enzymes [BR:acy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Anacy_5292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5993546..5994340
Genome map
AA seq 264 aa AA seqDB search
MSSTLPLSGKTILVTRSVGQSSQFSDRLSAAGATVIEMPALEIGPPSSWKALDQAIINLS
TFDWLILTSSNAVDYFFQRLHTQGKDKSNLKKIKIAVVGEKTAQSLKKHSIRPNFIPPHF
IADSLVTNFPENLAGKKILFPRVETGGREVLVKELTAKGAEVIEVPAYESCCPQNIPPAA
ELALQNHTLDVITFASSKTVQFFYLLATSKLTNGVTHYFDKICIASIGPQTSKICSDLFG
RVDIEAEEYTVDGLIKAIIKWSKG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcactcttcctctttcaggtaaaaccattctagtcacacgttcagttggacag
tcaagccaatttagcgatcgcttgtcggcagcaggtgctacagtcattgaaatgccagct
ttagaaattggccctccttccagctggaaagctttagatcaggcaattattaatttatca
acttttgactggttaattctcacttctagcaacgctgtagactacttttttcaaagactt
cacacccaaggtaaagataaaagtaatttaaaaaagattaaaattgccgttgttggtgaa
aaaacagcccaaagtcttaaaaaacacagtattcgtcctaattttattcctcctcacttt
atcgctgactccttagtaaccaactttcctgaaaacttagcaggtaaaaagattttattt
cctagagtcgaaaccgggggtagagaagttttagttaaagaattaaccgctaaaggtgca
gaagttatagaagttcccgcttatgaatcttgttgtccccagaatattcccccagcagca
gaattagctttacaaaatcataccctagatgtaattacctttgctagctccaagactgtg
cagtttttctatctattagcaactagtaaattaacaaatggagtgacacattatttcgac
aaaatttgtattgcttctattggcccccaaacttctaaaatctgctctgatttattcgga
cgtgttgatattgaagctgaggaatatactgtagatggtttaataaaagcaattataaaa
tggtctaaagggtga

DBGET integrated database retrieval system